spacer

EBI Dbfetch

ID   D50709; SV 1; linear; genomic DNA; STD; HUM; 899 BP.
XX
AC   D50709;
XX
DT   24-NOV-1997 (Rel. 53, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens DNA for HLA-B*4202, partial cds.
XX
KW   HLA-B*4202.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-899
RA   Ando H.;
RT   ;
RL   Submitted (27-MAY-1995) to the INSDC.
RL   Hitoshi Ando, Japanese Red Cross, Kanagawa Shonan Blood Center, Section of
RL   Technology; 1837 Aiko, Atsugi, Kanagawa 243, Japan
RL   (E-mail:hando@is.icc.u-tokai.ac.jp, Tel:0462-28-9800, Fax:0462-28-0310)
XX
RN   [2]
RP   1-899
RA   Ando H., Mizuki N., Ohno S., Inoko H.;
RT   "Identification of new HLA-B alleles among Saudi Arabian population";
RL   Unpublished.
XX
RN   [3]
RX   DOI; 10.1111/j.1399-0039.1997.tb02792.x.
RX   PUBMED; 9174150.
RA   Ando H., Mizuki N., Ohno S., Tabbara K.F., Taguchi S., Yamazaki M.,
RA   Mizuki N., Miyata Y., Wakisaka K., Inoko H.;
RT   "Identification of a novel HLA-B allele (B*4202) in a Saudi Arabian family
RT   with Behcet's disease";
RL   Tissue Antigens 49(5):526-528(1997).
XX
DR   MD5; 6da80ca6d96a7d2771bf9440a9ffe5f6.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..899
FT                   /organism="Homo sapiens"
FT                   /isolate="Saudi Arabian"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<73..342,589..>864)
FT                   /codon_start=3
FT                   /product="HLA-B*4202"
FT                   /db_xref="GOA:O19616"
FT                   /db_xref="IMGT/HLA:B*42:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:O19616"
FT                   /protein_id="BAA23589.1"
FT                   /translation="SHSMRYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGP
FT                   DGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQDRAYLEGTC
FT                   VEWLRRYLENGKDTLERA"
FT   exon            73..341
FT                   /number=2
FT   exon            588..863
FT                   /number=3
XX
SQ   Sequence 899 BP; 155 A; 304 C; 328 G; 112 T; 0 other;
     gcgggggcgc aggacctgag gagccgcgcc gggaggaggg tcgggcgggt ctcagcccct        60
     cctcaccccc aggctcccac tccatgaggt atttccacac ctccgtgtcc cggcccggcc       120
     gcggggagcc ccgcttcatc tcagtgggct acgtggacga cacccagttc gtgaggttcg       180
     acagcgacgc cgcgagtccg agagaggagc cgcgggcgcc gtggatagag caggaggggc       240
     cggagtattg ggaccggaac acacagatct acaaggccca ggcacagact gaccgagaga       300
     gcctgcggaa cctgcgcggc tactacaacc agagcgaggc cggtgagtga ccccggcccg       360
     gggcgcaggt cacgactccc catcccccac ggacggcccg ggtcgccccg agtctccggg       420
     tccgagatcc gcctccctga ggccgcggga cccgcccaga ccctcgaccg gcgagagccc       480
     caggcgcgtt tacccggttt cattttcagt tgaggccaaa atccccgcgg gttggtcggg       540
     gcggggcggg gctcgggggg acggggctga ccgcggggcc ggggccaggg tctcacaccc       600
     tccagagcat gtacggctgc gacgtggggc cggacgggcg cctcctccgc gggcataacc       660
     agtacgccta cgacggcaag gattacatcg ccctgaacga ggacctgcgc tcctggaccg       720
     cggcggacac cgcggctcag atcacccagc gcaagtggga ggcggcccgt gtggcggagc       780
     aggacagagc ctacctggag ggcacgtgcg tggagtggct ccgcagatac ctggagaacg       840
     ggaaggacac gctggagcgc gcgggtacca ggggcagtgg ggagccttcc ccatctcct        899
//


spacer
spacer