Dbfetch

ID   D50458; SV 1; linear; genomic DNA; STD; HUM; 500 BP.
XX
AC   D50458;
XX
DT   09-MAY-1995 (Rel. 43, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Homo sapiens gene for HLA-A2 antigen, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-500
RA   Ishikawa Y.;
RT   ;
RL   Submitted (29-APR-1995) to the INSDC.
RL   Yoshihide Ishikawa, Tokyo Red Cross Central Blood Center, Research; 1-26-1
RL   kyounqnn-cho, Musashino-shi, Tokyo 180, Japan (Tel:81-3-5485-6009,
RL   Fax:81-3-3406-7892)
XX
RN   [2]
RP   1-500
RA   Ishikawa Y., Tokunaga K.;
RT   "Hla-a2 allele";
RL   Unpublished.
XX
DR   MD5; 2693592f2cf73da8ac14a53a014b6c53.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..500
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="KTO"
FT                   /mol_type="genomic DNA"
FT                   /sex="male"
FT                   /cell_type="lymphocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>500
FT                   /codon_start=1
FT                   /product="HLA-A2 antigen"
FT                   /db_xref="IMGT/HLA:A*02:07:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:P79495"
FT                   /protein_id="BAA09049.1"
FT                   /translation="FFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWI
FT                   EQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMCGCDVGSDWRFLR
FT                   GYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRR
FT                   YLE"
XX
SQ   Sequence 500 BP; 100 A; 148 C; 179 G; 73 T; 0 other;
     ttcttcacat ccgtgtcccg gcccggccgc ggggagcccc gcttcatcgc agtgggctac        60
     gtggacgaca cgcagttcgt gcggttcgac agcgacgccg cgagccagag gatggagccg       120
     cgggcgccgt ggatagagca ggagggtccg gagtattggg acggggagac acggaaagtg       180
     aaggcccact cacagactca ccgagtggac ctggggaccc tgcgcggcta ctacaaccag       240
     agcgaggccg gttctcacac cgtccagagg atgtgtggct gcgacgtggg gtcggactgg       300
     cgcttcctcc gcgggtacca ccagtacgcc tacgacggca aggattacat cgccctgaaa       360
     gaggacctgc gctcttggac cgcggcggac atggcagctc agaccaccaa gcacaagtgg       420
     gaggcggccc atgtggcgga gcagttgaga gcctacctgg agggcacgtg cgtggagtgg       480
     ctccgcagat acctggagaa                                                   500
//