spacer

EBI Dbfetch

ID   D50299; SV 1; linear; mRNA; STD; HUM; 1089 BP.
XX
AC   D50299;
XX
DT   26-APR-1995 (Rel. 43, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 8)
XX
DE   Homo sapiens mRNA for HLA-B35 antigen, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1089
RA   Lin L.;
RT   ;
RL   Submitted (13-APR-1995) to the INSDC.
RL   Ling Lin, Japan Red Cross Central Blood Center, Department of Research;
RL   4-1-31 Hiroo, Shibuya-ku, Tokyo 150, Japan (Tel:81-3-5485-6009,
RL   Fax:81-3-3406-7892)
XX
RN   [2]
RP   1-1089
RA   Beck Y., Satz L., Takamiya Y., Nakayama S., Lin L., Ishikawa Y., Nagao T.,
RA   Uchida H., Tokunaga K., Muller C., Juji T., Takiguchi M.;
RT   "Polymorphism of Human Minor Histocompatibility Antigens: T Cell
RT   Recognition of Human Histocompatibility Peptides Presented by HLA-B35
RT   Subtype Molecules";
RL   Tissue Antigens 0:0-0(1995).
XX
DR   MD5; fca4bbe634a83b2a87438cb91567b053.
DR   Ensembl-Gn; ENSG00000206450; homo_sapiens.
DR   Ensembl-Tr; ENST00000359635; homo_sapiens.
DR   H-InvDB; HIT000101550_03.4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1089
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="12405, 13159"
FT                   /mol_type="mRNA"
FT                   /cell_type="lymphocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             1..1089
FT                   /codon_start=1
FT                   /product="HLA-B35 antigen"
FT                   /db_xref="GOA:P30685"
FT                   /db_xref="H-InvDB:HIT000101550_02.4"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*35:03:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="PDB:1A1N"
FT                   /db_xref="PDB:1A9B"
FT                   /db_xref="PDB:1A9E"
FT                   /db_xref="PDB:1CG9"
FT                   /db_xref="PDB:1XH3"
FT                   /db_xref="PDB:1ZHK"
FT                   /db_xref="PDB:1ZHL"
FT                   /db_xref="PDB:1ZSD"
FT                   /db_xref="PDB:2AK4"
FT                   /db_xref="PDB:2AXF"
FT                   /db_xref="PDB:2AXG"
FT                   /db_xref="PDB:2CIK"
FT                   /db_xref="PDB:2FYY"
FT                   /db_xref="PDB:2FZ3"
FT                   /db_xref="PDB:2H6P"
FT                   /db_xref="PDB:2NW3"
FT                   /db_xref="PDB:2NX5"
FT                   /db_xref="PDB:3BW9"
FT                   /db_xref="PDB:3BWA"
FT                   /db_xref="PDB:3KWW"
FT                   /db_xref="PDB:3KXF"
FT                   /db_xref="PDB:3LKN"
FT                   /db_xref="PDB:3LKO"
FT                   /db_xref="PDB:3LKP"
FT                   /db_xref="PDB:3LKQ"
FT                   /db_xref="PDB:3LKR"
FT                   /db_xref="PDB:3LKS"
FT                   /db_xref="PDB:3MV7"
FT                   /db_xref="PDB:3MV8"
FT                   /db_xref="PDB:3MV9"
FT                   /db_xref="PDB:3VFS"
FT                   /db_xref="PDB:3VFT"
FT                   /db_xref="PDB:3VFU"
FT                   /db_xref="PDB:3VFV"
FT                   /db_xref="PDB:3VFW"
FT                   /db_xref="PDB:4PR5"
FT                   /db_xref="PDB:4PRN"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30685"
FT                   /protein_id="BAA08828.1"
FT                   /translation="MRVTAPRTVLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRN
FT                   LRGYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQFAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGGK
FT                   GGSYSQAASSDSAQGSDVSLTA"
XX
SQ   Sequence 1089 BP; 222 A; 335 C; 358 G; 174 T; 0 other;
     atgcgggtca cggcgccccg aaccgtcctc ctgctgctct ggggggcagt ggccctgacc        60
     gagacctggg ccggctccca ctccatgagg tatttctaca ccgccatgtc ccggcccggc       120
     cgcggggagc cccgcttcat cgcagtgggc tacgtggacg acacccagtt cgtgaggttc       180
     gacagcgacg ccgcgagtcc gaggacggag ccccgggcgc catggataga gcaggagggg       240
     ccggagtatt gggaccggaa cacacagatc ttcaagacca acacacagac ttaccgagag       300
     agcctgcgga acctgcgcgg ctactacaac cagagcgagg ccgggtctca catcatccag       360
     aggatgtatg gctgcgacct ggggcccgac gggcgcctcc tccgcgggca tgaccagttc       420
     gcctacgacg gcaaggatta catcgccctg aacgaggacc tgagctcctg gaccgcggcg       480
     gacaccgcgg ctcagatcac ccagcgcaag tgggaggcgg cccgtgtggc ggagcagctg       540
     agagcctacc tggagggcct gtgcgtggag tggctccgca gatacctgga gaacgggaag       600
     gagacgctgc agcgcgcgga ccccccaaag acacacgtga cccaccaccc cgtctctgac       660
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc       720
     tggcagcggg atggcgagga ccaaactcag gacactgagc ttgtggagac cagaccagca       780
     ggagatagaa ccttccagaa gtgggcagct gtggtggtgc cttctggaga agagcagaga       840
     tacacatgcc atgtacagca tgaggggctg ccgaagcccc tcaccctgag atgggagcca       900
     tcttcccagt ccaccatccc catcgtgggc attgttgctg gcctggctgt cctagcagtt       960
     gtggtcatcg gagctgtggt cgctactgtg atgtgtagga ggaagagctc aggtggaaaa      1020
     ggagggagct actctcaggc tgcgtccagc gacagtgccc agggctctga tgtgtctctc      1080
     acagcttga                                                              1089
//


spacer
spacer