spacer

EBI Dbfetch

ID   D50291; SV 1; linear; mRNA; STD; HUM; 1089 BP.
XX
AC   D50291;
XX
DT   26-APR-1995 (Rel. 43, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 9)
XX
DE   Homo sapiens mRNA for HLA-B*1302 antigen, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1089
RA   Lin L.;
RT   ;
RL   Submitted (13-APR-1995) to the INSDC.
RL   Ling Lin, Japan Red Cross Central Blood Center, Department of Research;
RL   4-1-31 Hiroo, Shibuya-ku, Tokyo 150, Japan (Tel:81-3-5485-6009,
RL   Fax:81-3-3406-7892)
XX
RN   [2]
RX   DOI; 10.1016/0198-8859(94)00120-F.
RX   PUBMED; 7558929.
RA   Lin L., Tokunaga K., Nakajima F., Ishikawa Y., Kashiwase K., Tanaka H.,
RA   Kuwata S., Sideltseva E., Akaza T., Tadokoro K., Shibata Y.,
RA   Chandanayingyong D., Juji T.;
RT   "Both HLA-B*1301 and B*1302 exist in Asian populations and are associated
RT   with different haplotypes";
RL   Hum. Immunol. 43(1):51-56(1995).
XX
DR   MD5; 71dae8cd567dfb0c6140cb18ad82c361.
DR   Ensembl-Gn; ENSG00000224608; homo_sapiens.
DR   Ensembl-Tr; ENST00000435618; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1089
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="HJB, PKM, TAC"
FT                   /mol_type="mRNA"
FT                   /sex="male, female"
FT                   /cell_type="lymphocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             1..1089
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /product="HLA-B*1302 antigen"
FT                   /db_xref="GOA:P30461"
FT                   /db_xref="H-InvDB:HIT000101544.10"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*13:02:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30461"
FT                   /protein_id="BAA08822.1"
FT                   /translation="MRVTAPRTLLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FITVGYVDDTQFVRFDSDATSPRMAPRAPWIEQEGPEYWDRETQISKTNTQTYRENLRT
FT                   ALRYYNQSEAGSHTWQTMYGCDLGPDGRLLRGHNQLAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQLKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGK
FT                   GGSYSQAACSDSAQGSDVSLTA"
XX
SQ   Sequence 1089 BP; 222 A; 336 C; 357 G; 174 T; 0 other;
     atgcgggtca cggcgccccg aaccctcctc ctgctgctct ggggggcagt ggccctgacc        60
     gagacctggg ccggctccca ctccatgagg tatttctaca ccgccatgtc ccggcccggc       120
     cgcggggagc cccgcttcat caccgtgggc tacgtggacg acacccagtt cgtgaggttc       180
     gacagcgacg ccacgagtcc gaggatggcg ccccgggcgc catggataga gcaggagggg       240
     ccggagtatt gggaccggga gacacagatc tccaagacca acacacagac ttaccgagag       300
     aacctgcgca ccgcgctccg ctactacaac cagagcgagg ccgggtctca cacttggcag       360
     acgatgtatg gctgcgacct ggggccggac gggcgcctcc tccgcgggca taaccagtta       420
     gcctacgacg gcaaggatta catcgccctg aacgaggacc tgagctcctg gaccgcggcg       480
     gacaccgcgg ctcagatcac ccagctcaag tgggaggcgg cccgtgtggc ggagcagctg       540
     agagcctacc tggagggcga gtgcgtggag tggctccgca gatacctgga gaacgggaag       600
     gagacgctgc agcgcgcgga ccccccaaag acacacgtga cccaccaccc catctctgac       660
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc       720
     tggcagcggg atggcgagga ccaaactcag gacactgagc ttgtggagac cagaccagca       780
     ggagatagaa ccttccagaa gtgggcagct gtggtggtgc cttctggaga agagcagaga       840
     tacacatgcc atgtacagca tgaggggctg ccgaagcccc tcaccctgag atgggagcca       900
     tcttcccagt ccaccgtccc catcgtgggc attgttgctg gcctggctgt cctagcagtt       960
     gtggtcatcg gagctgtggt cgctgctgtg atgtgtagga ggaagagctc aggtggaaaa      1020
     ggagggagct actctcaggc tgcgtgcagc gacagtgccc agggctctga tgtgtctctc      1080
     acagcttga                                                              1089
//


spacer
spacer