spacer

EBI Dbfetch

ID   D49820; SV 1; linear; mRNA; STD; HUM; 822 BP.
XX
AC   D49820;
XX
DT   24-JAN-2000 (Rel. 62, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Homo sapiens Cw*1402 mRNA for MHC class I antigen, partial cds.
XX
KW   HLA-C; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-822
RA   Wang H.;
RT   ;
RL   Submitted (22-MAR-1995) to the INSDC.
RL   Huiru Wang, Japanese Red Cross Central Blood Center, Department of
RL   Research; 4-1-31 Hiroo, Shibuya-ku, Tokyo 150, Japan
RL   (E-mail:juji@cbc.jrc.or.jp, Tel:03-5485-6009, Fax:03-3406-7892)
XX
RN   [2]
RP   1-822
RX   DOI; 10.1111/j.1399-0039.1996.tb02584.x.
RX   PUBMED; 8795149.
RA   Wang H., Tokunaga K., Ogawa A., Akaza T., Tadokoro K., Takiguchi M.,
RA   Shibata Y., Juji T.;
RT   "DNA typing of Cw*14 alleles in Japanese and the corrected sequence of
RT   Cw*1402";
RL   Tissue Antigens 47(5):442-446(1996).
XX
DR   MD5; d78a5eda25f9367091d86dd3f31d5744.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..822
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="LKT2"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /clone="Cb-1"
FT                   /cell_type="Lymphocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>822
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /product="MHC class I antigen"
FT                   /note="allele:Cw*1402"
FT                   /db_xref="GOA:P30510"
FT                   /db_xref="H-InvDB:HIT000101533.9"
FT                   /db_xref="HGNC:HGNC:4933"
FT                   /db_xref="IMGT/HLA:C*14:02:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30510"
FT                   /protein_id="BAA89793.1"
FT                   /translation="SHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHTLQWMFGCDLGP
FT                   DGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQRRAYLEGTC
FT                   VEWLRRYLENGKETLQRAEHPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQWDGED
FT                   QTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRW"
FT   exon            1..270
FT                   /number=2
FT   exon            271..546
FT                   /number=3
FT   exon            547..822
FT                   /number=4
XX
SQ   Sequence 822 BP; 166 A; 252 C; 290 G; 114 T; 0 other;
     gctcccactc catgaggtat ttctccacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccgag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacagactga ccgagtgagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg ggtctcacac cctccagtgg atgtttggct       300
     gcgacctggg gcccgacggg cgcctcctcc gcgggtatga ccagtccgcc tacgacggca       360
     aggattacat cgccctgaac gaggatctgc gctcctggac cgccgcggac acggcggctc       420
     agatcaccca gcgcaagtgg gaggcggccc gtgaggcgga gcagcggaga gcctacctgg       480
     agggcacgtg cgtggagtgg ctccgcagat acctggagaa cgggaaggag acgctgcagc       540
     gcgcggaaca cccaaagaca cacgtgaccc accatcccgt ctctgaccat gaggccaccc       600
     tgaggtgctg ggccctgggc ttctaccctg cggagatcac actgacctgg cagtgggatg       660
     gggaggacca aactcaggac accgagcttg tggagaccag gccagcagga gatggaacct       720
     tccagaagtg ggcagctgtg gtggtgcctt ctggagaaga gcagagatac acgtgccatg       780
     tgcagcacga ggggctgccg gagcccctca ccctgagatg gg                          822
//


spacer
spacer