Dbfetch

ID   D49552; SV 1; linear; mRNA; STD; HUM; 1101 BP.
XX
AC   D49552;
XX
DT   26-SEP-1996 (Rel. 49, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens mRNA for HLA-Cw*0704, complete cds.
XX
KW   HLA-Cw*0704.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1101
RA   Wang H.;
RT   ;
RL   Submitted (09-MAR-1995) to the INSDC.
RL   Huiru Wang, Japanese Red Cross Central Blood Center, Department of
RL   Research; 4-1-31 Hiroo, Shibuya-ku, Tokyo 150, Japan (Tel:03-5485-6009,
RL   Fax:03-3406-7892)
XX
RN   [2]
RP   1-1101
RA   Wang H.;
RT   "Human mRNA for HLA-Cw*0704, complete cds.";
RL   Unpublished.
XX
RN   [3]
RX   DOI; 10.1016/0198-8859(95)00150-6.
RX   PUBMED; 8655361.
RA   Wang H., Tokunaga K., Ishikawa Y., Asahina A., Kuwata S., Akaza T.,
RA   Tadokoro K., Shibata Y., Takiguchi M., Juji T.;
RT   "Identification and DNA typing of two Cw7 alleles (Cw*0702 and Cw*0704) in
RT   Japanese, with the corrected sequence of Cw*0702";
RL   Hum. Immunol. 45(1):52-58(1996).
XX
DR   MD5; 2c5dc233ee66eeb0334ac306846e665a.
DR   Ensembl-Gn; ENSG00000204525; homo_sapiens.
DR   Ensembl-Tr; ENST00000376228; homo_sapiens.
DR   H-InvDB; HIT000101522_04.4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1101
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="SSA"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /clone="S1, S2, S4, S6, S9"
FT                   /cell_type="lymphocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             1..1101
FT                   /codon_start=1
FT                   /product="HLA-Cw*0704"
FT                   /db_xref="GOA:P10321"
FT                   /db_xref="H-InvDB:HIT000101522_03.4"
FT                   /db_xref="HGNC:HGNC:4933"
FT                   /db_xref="IMGT/HLA:C*07:04:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="PDB:3BZF"
FT                   /db_xref="PDB:5VGE"
FT                   /db_xref="UniProtKB/Swiss-Prot:P10321"
FT                   /protein_id="BAA08500.1"
FT                   /translation="MRVMAPRALLLLLSGGLALTETWACSHSMRYFDTAVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQADRVSLRN
FT                   LRGYYNQSEDGSHTFQRMYGCDLGPDGRLLRGYDQFAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKLEAARAAEQDRAYLEGTCVEWLRRYLENGKKTLQRAEPPKTHVTHHPLSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRY
FT                   TCHMQHEGLQEPLTLSWEPSSQPTIPIMGIVAGLAVLVVLAVLGAVVTAMMCRRKSSGG
FT                   KGGSCSQAACSNSAQGSDESLITCKA"
XX
SQ   Sequence 1101 BP; 216 A; 345 C; 368 G; 172 T; 0 other;
     atgcgggtca tggcgccccg agccctcctc ctgctgctct cgggaggcct ggccctgacc        60
     gagacctggg cctgctccca ctccatgagg tatttcgaca ccgccgtgtc ccggcccggc       120
     cgcggagagc cccgcttcat ctcagtgggc tacgtggacg acacgcagtt cgtgcggttc       180
     gacagcgacg ccgcgagtcc gagaggggag ccccgggcgc cgtgggtgga gcaggagggg       240
     ccggagtatt gggaccggga gacacagaag tacaagcgcc aggcacaggc tgaccgagtg       300
     agcctgcgga acctgcgcgg ctactacaac cagagcgagg acgggtctca caccttccag       360
     aggatgtatg gctgcgacct ggggcccgac gggcgcctcc tccgcgggta tgaccagttc       420
     gcctacgacg gcaaggatta catcgccctg aacgaggacc tgcgctcctg gaccgccgcg       480
     gacaccgcgg ctcagatcac ccagcgcaag ttggaggcgg cccgtgcggc ggagcaggac       540
     agagcctacc tggagggcac gtgcgtggag tggctccgca gatacctgga gaacgggaag       600
     aagacgctgc agcgcgcgga acccccaaag acacacgtga cccaccaccc cctctctgac       660
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc       720
     tggcagcggg atggggagga ccagacccag gacaccgagc ttgtggagac caggccagca       780
     ggagatggaa ccttccagaa gtgggcagct gtggtggtgc cttctggaca agagcagaga       840
     tacacgtgcc atatgcagca cgaggggctg caagagcccc tcaccctgag ctgggagcca       900
     tcttcccagc ccaccatccc catcatgggc atcgttgctg gcctggctgt cctggttgtc       960
     ctagctgtcc ttggagctgt ggtcaccgct atgatgtgta ggaggaagag ctcaggtgga      1020
     aaaggaggga gctgctctca ggctgcgtgc agcaacagtg cccagggctc tgatgagtct      1080
     ctcatcactt gtaaagcctg a                                                1101
//