spacer

EBI Dbfetch

ID   D45046; SV 1; linear; genomic DNA; STD; HUM; 213 BP.
XX
AC   D45046;
XX
DT   21-APR-1995 (Rel. 43, Created)
DT   26-SEP-2008 (Rel. 97, Last updated, Version 10)
XX
DE   Homo sapiens HLA-D8.2V gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-213
RA   Kashiwase K.;
RT   ;
RL   Submitted (07-JAN-1995) to the INSDC.
RL   Contact:Kouichi Kashiwase Japanese Central Red Cross Blood Center, 3rd
RL   Laboratory; Hiroo 4-1-31, Shibuya-ku, Tokyo 150, Japan
XX
RN   [2]
RP   1-213
RX   DOI; 10.1111/j.1399-0039.1995.tb02505.x.
RX   PUBMED; 8560457.
RA   Kashiwase K., Tokunaga K., Lin L., Sugahara N., Miyamoto M., Akaza T.,
RA   Tadokoro K., Juji T.;
RT   "A new HLA-DR8 subtype showing unusual serological reaction and the
RT   confirmatory sequence of DRB1*0809";
RL   Tissue Antigens 46(4):340-342(1995).
XX
DR   MD5; 0534faca1853d0668949faf7e3b47f22.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..213
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="JB44585"
FT                   /mol_type="genomic DNA"
FT                   /sex="male"
FT                   /haplotype="A2,A24-B54,B60-Cw1,Cw7-DR8.2V,DR4.1,DR53-DQ4"
FT                   /cell_type="lymphocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>213
FT                   /codon_start=3
FT                   /gene="HLA-D8.2V"
FT                   /allele="HLA-DRB1*0809"
FT                   /note="a part of exon2"
FT                   /note="DRB1 allele"
FT                   /note="HLA-DR8 subtype HLA-D8.2V"
FT                   /db_xref="GOA:Q29799"
FT                   /db_xref="IMGT/HLA:DRB1*08:09"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q29799"
FT                   /protein_id="BAA08086.1"
FT                   /translation="FFNGTERVRFLDRYFHNQEEFVRFDSDVGEYRAVTELGRPDAEYW
FT                   NSQKDFLEDRRALVDTYCRHNYGVG"
FT   exon            <1..>213
FT                   /number=2
XX
SQ   Sequence 213 BP; 45 A; 51 C; 79 G; 38 T; 0 other;
     atttcttcaa tgggacggag cgggtgcggt tcctggacag atacttccat aaccaggagg        60
     agttcgtgcg cttcgacagc gacgtggggg agtaccgggc ggtgacggag ctggggcggc       120
     ctgatgccga gtactggaac agccagaagg acttcctgga agacaggcgg gccctggtgg       180
     acacctactg cagacacaac tacggggttg gtg                                    213
//


spacer
spacer