Dbfetch

ID   D32130; SV 1; linear; mRNA; STD; HUM; 1385 BP.
XX
AC   D32130;
XX
DT   15-JUL-1994 (Rel. 40, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 11)
XX
DE   Homo sapiens HLA-A26 mRNA for HLA class-I heavy chain, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1385
RA   Miyashita H.;
RT   ;
RL   Submitted (09-JUL-1994) to the INSDC.
RL   Hiroki Miyashita, Faculty of Medicine, Kagoshima University, Department of
RL   Virology; 8-35-1 Sakuragaoka, Kagoshima, Kagoshima 890, Japan
RL   (Tel:81-992-75-5282, Fax:81-992-65-8164)
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.1995.tb03134.x.
RX   PUBMED; 8838351.
RA   Miyashita H., Fujiyoshi T., Yashiki S., Kuwayama M., Fujiyama C.,
RA   Sonoda S.;
RT   "Cloning of HLA-A26 cDNA from Japanese donors possessing ATL-associated HLA
RT   haplotypes";
RL   Tissue Antigens 46(5):398-400(1995).
XX
DR   MD5; d4451ae912cfdae43ebe34deb7ce25a5.
DR   Ensembl-Gn; ENSG00000206505; homo_sapiens.
DR   Ensembl-Tr; ENST00000383605; homo_sapiens.
DR   Ensembl-Tr; ENST00000549224; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1385
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone="cMIY-2"
FT                   /cell_line="MIY-2"
FT                   /cell_type="B-lymphocyte"
FT                   /db_xref="taxon:9606"
FT   5'UTR           1..53
FT   regulatory      1..7
FT                   /regulatory_class="TATA_box"
FT   CDS             54..1151
FT                   /codon_start=1
FT                   /gene="HLA-A26"
FT                   /product="HLA class I heavy chain"
FT                   /note="exon 1 part (leader region): bp54-125"
FT                   /note="exon 2 part (alpha-1 domain): bp126-395"
FT                   /note="exon 3 part (alpha-2 domain): bp396-671"
FT                   /note="exon 4 part (alpha-3 domain): bp672-947"
FT                   /note="exon 5 part (transmembrane region): bp948-1064"
FT                   /note="exon 6 part (cytoplasmic region): bp1065-1097"
FT                   /note="exon 7 part (cytoplasmic region): bp1098-1145"
FT                   /note="exon 8 part (cytoplasmic region): bp1146-1151"
FT                   /db_xref="GOA:P30450"
FT                   /db_xref="H-InvDB:HIT000101397.14"
FT                   /db_xref="HGNC:HGNC:4931"
FT                   /db_xref="IMGT/HLA:A*26:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30450"
FT                   /protein_id="BAA06856.1"
FT                   /translation="MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFYTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDRNTRNVKAHSQTDRANLGT
FT                   LRGYYNQSEDGSHTIQRMYGCDVGPDGRFLRGYQQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITQRKWETAHEAEQWRAYLEGRCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWASVVVPSGQEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVIAGAVVAAVMWRRKSSDRK
FT                   GGSYSQAASSDSAQGSDMSLTACKV"
FT   3'UTR           1152..1385
FT   regulatory      1352..1357
FT                   /regulatory_class="polyA_signal_sequence"
XX
SQ   Sequence 1385 BP; 270 A; 419 C; 444 G; 252 T; 0 other;
     ttctaaagtc cgcacgcacc caccgggact cagattctcc ccagacgccg aggatggccg        60
     tcatggcgcc ccgaaccctc gtcctgctac tctcgggggc cctggccctg acccagacct       120
     gggcgggctc ccactccatg aggtatttct acacctccgt gtcccggccc ggccgcgggg       180
     agccccgctt catcgccgtg ggctacgtgg acgacacgca gttcgtgcgg ttcgacagcg       240
     acgccgcgag ccagaggatg gagccgcggg cgccgtggat agagcaggag gggccggagt       300
     attgggaccg gaacacacgg aatgtgaagg cccactcaca gactgaccga gcgaacctgg       360
     ggaccctgcg cggctactac aaccagagcg aggacggttc tcacaccatc cagaggatgt       420
     atggctgcga cgtggggccg gacgggcgct tcctccgcgg gtaccagcag gacgcttacg       480
     acggcaagga ttacatcgcc ctgaacgagg acctgcgctc ttggaccgcg gcggacatgg       540
     cggctcagat cacccagcgc aagtgggaga cggcccatga ggcggagcag tggagagcct       600
     acctggaggg ccggtgcgtg gagtggctcc gcagatacct ggagaacggg aaggagacgc       660
     tgcagcgcac ggacgccccc aagacgcata tgactcacca cgctgtctct gaccatgagg       720
     ccaccctgag gtgctgggcc ctgagcttct accctgcgga gatcacactg acctggcagc       780
     gggatgggga ggaccagacc caggacacgg agctcgtgga gaccaggcct gcaggggatg       840
     ggaccttcca gaagtgggcg tctgtggtgg tgccttctgg acaggagcag agatacacct       900
     gccatgtgca gcatgagggt ctgcccaagc ccctcaccct gagatgggag ccgtcttccc       960
     agcccaccat ccccatcgtg ggcatcattg ctggcctggt tctctttgga gctgtgatcg      1020
     ctggagctgt ggtcgctgct gtgatgtgga ggaggaagag ctcagataga aaaggaggga      1080
     gctactctca ggctgcaagc agtgacagtg cccagggctc tgatatgtct ctcacagctt      1140
     gtaaagtgtg agacagctgc cttgtgtggg actgagaggc aagatttgtt cctgcccttc      1200
     cctttgtgac ttgaagaacc ctgactttgt ttctgcaaag gcacctgcat gtgtctgtgt      1260
     tcttgtaggc ataatgtgag gaggtgggga gaccacccca cccccatgtc caccatgacc      1320
     ctcttcccac gctgacctgt gctccctccc caatcatctt tcctgttcca gagaggtggg      1380
     gctga                                                                  1385
//