spacer

EBI Dbfetch

ID   D29836; SV 1; linear; genomic DNA; STD; HUM; 273 BP.
XX
AC   D29836;
XX
DT   11-MAY-1994 (Rel. 39, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 10)
XX
DE   Homo sapiens HLA-DRB1 gene for MHC class II antigen, partial cds,
DE   allele:HLA-DRB1*131.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-273
RA   Hu C.J.;
RT   ;
RL   Submitted (12-APR-1994) to the INSDC.
RL   Contact:Chung-Yi Joy Hu National Taiwan University, College of Medicine,
RL   School/Institute of Medical Technology; No.1 Chang-Te street, Taipei 10015,
RL   Taiwan
XX
RN   [2]
RP   1-273
RA   Hu C.J.;
RT   "DR variant with a DR5-like-haplotype found in Taiwan";
RL   Unpublished.
XX
DR   MD5; 86f292251121e5f64d73ed856acbb457.
DR   Ensembl-Gn; ENSG00000206240; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206306; homo_sapiens.
DR   Ensembl-Tr; ENST00000328980; homo_sapiens.
DR   Ensembl-Tr; ENST00000399450; homo_sapiens.
DR   Ensembl-Tr; ENST00000415796; homo_sapiens.
DR   Ensembl-Tr; ENST00000428566; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..273
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="DRB1*1312/DQA1*0501/DQB1*0301"
FT                   /note="clones cc75-1 N170-1"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>273
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1312"
FT                   /product="MHC class II antigen"
FT                   /note="a part of exon 2"
FT                   /db_xref="GOA:Q5Y7A7"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*13:12:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5Y7A7"
FT                   /protein_id="BAA06216.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEYRAV
FT                   TELGRPSAEYWNSQKDILEDRRAAVDTYCRHNYGVGESFTVQRRG"
FT   exon            <1..>273
FT                   /number=2
FT                   /note="NA 14-286 of the second exon of DRB1*1312"
XX
SQ   Sequence 273 BP; 59 A; 65 C; 98 G; 51 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctagcgc cgagtactgg aacagccaga       180
     aggacatcct ggaagacagg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag gtg                                    273
//


spacer
spacer