spacer

EBI Dbfetch

ID   D16842; SV 1; linear; mRNA; STD; HUM; 1098 BP.
XX
AC   D16842;
XX
DT   14-JAN-1994 (Rel. 38, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 15)
XX
DE   Homo sapiens A1102 mRNA for HLA-A11 antigen A11.2, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1098
RA   Lin L., Tokunaga K., Ishikawa Y., Bannai M., Kashiwase K., Kuwata S.,
RA   Akaza T., Tadokoro K., Shibata Y., Juji T.;
RT   ;
RL   Submitted (20-JUL-1993) to the INSDC.
RL   Contact:Ling Lin Japanese Red Cross Central Blood Center, Department of
RL   Research; 4-3-31 Hiroo, Shibuya-ku, Tokyo 150, Japan
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.1994.tb02304.x.
RX   PUBMED; 8016845.
RA   Lin L., Tokunaga K., Ishikawa Y., Bannai M., Kashiwase K., Kuwata S.,
RA   Akaza T., Tadokoro K., Shibata Y., Juji T.;
RT   "Sequence analysis of serological HLA-A11 split antigens, A11.1 and A11.2";
RL   Tissue Antigens 43(2):78-82(1994).
XX
DR   MD5; 9014812a6697b8d16cd7ede6848589bc.
DR   Ensembl-Gn; ENSG00000206503; homo_sapiens.
DR   Ensembl-Tr; ENST00000376809; homo_sapiens.
DR   Ensembl-Tr; ENST00000396634; homo_sapiens.
DR   H-InvDB; HIT000100620_04.4.
DR   H-InvDB; HIT000100620_05.4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1098
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="KOK"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /haplotype="HLA-A11.2-Cw7-B7-DR1"
FT                   /cell_type="lymphocyte"
FT                   /tissue_type="blood"
FT                   /note="identical sequence is also seen in isolate:MTA
FT                   (haplotype:HLA-A11.2-Cw--B27-DR4.1)"
FT                   /db_xref="taxon:9606"
FT   CDS             1..1098
FT                   /codon_start=1
FT                   /gene="A1102"
FT                   /product="HLA-A11 antigen A11.2"
FT                   /db_xref="GOA:P13746"
FT                   /db_xref="H-InvDB:HIT000100620_03.4"
FT                   /db_xref="HGNC:HGNC:4931"
FT                   /db_xref="IMGT/HLA:A*11:02:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="PDB:1Q94"
FT                   /db_xref="PDB:1QVO"
FT                   /db_xref="PDB:1X7Q"
FT                   /db_xref="PDB:2HN7"
FT                   /db_xref="PDB:4BEO"
FT                   /db_xref="PDB:4MJ5"
FT                   /db_xref="PDB:4MJ6"
FT                   /db_xref="PDB:4N8V"
FT                   /db_xref="PDB:4UQ2"
FT                   /db_xref="UniProtKB/Swiss-Prot:P13746"
FT                   /protein_id="BAA04118.1"
FT                   /translation="MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFYTSVSRPGRGKPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGT
FT                   LRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITKRKWEAAHAAEQQRAYLEGRCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRK
FT                   GGSYTQAASSDSAQGSDVSLTACKV"
FT   misc_difference 582
FT                   /replace="g"
FT                   /citation=[2]
XX
SQ   Sequence 1098 BP; 220 A; 332 C; 370 G; 176 T; 0 other;
     atggccgtca tggcgccccg aaccctcctc ctgctactct cgggggccct ggccctgacc        60
     cagacctggg cgggctccca ctccatgagg tatttctaca cctccgtgtc ccggcccggc       120
     cgcgggaagc cccgcttcat cgccgtgggc tacgtggacg acacgcagtt cgtgcggttc       180
     gacagcgacg ccgcgagcca gaggatggag ccgcgggcgc cgtggataga gcaggagggg       240
     ccggagtatt gggaccagga gacacggaat gtgaaggccc agtcacagac tgaccgagtg       300
     gacctgggga ccctgcgcgg ctactacaac cagagcgagg acggttctca caccatccag       360
     ataatgtatg gctgcgacgt ggggccggac gggcgcttcc tccgcgggta ccggcaggac       420
     gcctacgacg gcaaggatta catcgccctg aacgaggacc tgcgctcttg gaccgcggcg       480
     gacatggcag ctcagatcac caagcgcaag tgggaggcgg cccatgcggc ggagcagcag       540
     agagcctacc tggagggccg gtgcgtggag tggctccgca gatacctgga gaacgggaag       600
     gagacgctgc agcgcacgga cccccccaag acacatatga cccaccaccc catctctgac       660
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc       720
     tggcagcggg atggggagga ccagacccag gacacggagc tcgtggagac caggcctgca       780
     ggggatggaa ccttccagaa gtgggcggct gtggtggtgc cttctggaga ggagcagaga       840
     tacacctgcc atgtgcagca tgagggtctg cccaagcccc tcaccctgag atgggagctg       900
     tcttcccagc ccaccatccc catcgtgggc atcattgctg gcctggttct ccttggagct       960
     gtgatcactg gagctgtggt cgctgccgtg atgtggagga ggaagagctc agatagaaaa      1020
     ggagggagtt acactcaggc tgcaagcagt gacagtgccc agggctctga tgtgtctctc      1080
     acagcttgta aagtgtga                                                    1098
//


spacer
spacer