Dbfetch

ID   D14352; SV 1; linear; genomic DNA; STD; HUM; 224 BP.
XX
AC   D14352;
XX
DT   13-JUN-1994 (Rel. 40, Created)
DT   26-SEP-2008 (Rel. 97, Last updated, Version 11)
XX
DE   Homo sapiens gene for HLA-DR11 DRB1*1106, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-224
RA   Bannai M.;
RT   ;
RL   Submitted (02-FEB-1993) to the INSDC.
RL   Contact:Makoto Bannai Japanese Red Cross Tokyo Metropolitan Blood Center,
RL   Department of Research; 1-26-1 Kyonan-cho, Musashino-shi, Tokyo 180, Japan
XX
RN   [2]
RX   DOI; 10.1016/0198-8859(94)90265-8.
RX   PUBMED; 8026992.
RA   Bannai M., Tokunaga K., Lin L., Park-Hee M., Kuwata S., Fujisawa K.,
RA   Juji T.;
RT   "A new HLA-DR11 DRB1 allele found in a Korean";
RL   Hum. Immunol. 39(3):230-232(1994).
XX
DR   MD5; 877464b1e54c817fa9864d4f6845de9a.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..224
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="PMH-161"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="A26-B61-Cw10-DR11-DQ7"
FT                   /cell_type="lymphocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>224
FT                   /codon_start=2
FT                   /product="HLA-DR11 DRB1*1106"
FT                   /note="a new HLA-DR11 DRB1 allele (tentatively called
FT                   DRB1*11PMH)"
FT                   /db_xref="GOA:Q31645"
FT                   /db_xref="IMGT/HLA:DRB1*11:06:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q31645"
FT                   /protein_id="BAA03281.1"
FT                   /translation="SECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAVTELGRPD
FT                   EEYWNSQKDFLEDRRAAVDTYCRHNYGAV"
XX
SQ   Sequence 224 BP; 48 A; 51 C; 84 G; 41 T; 0 other;
     gtctgagtgt catttcttca atgggacgga gcgggtgcgg ttcctggaca gatacttcta        60
     taaccaagag gagtacgtgc gcttcgacag cgacgtgggg gagttccggg cggtgacgga       120
     gctggggcgg cctgatgagg agtactggaa cagccagaag gacttcctgg aagacaggcg       180
     ggccgcggtg gacacctact gcagacacaa ctacggggct gtgg                        224
//