Dbfetch

ID   D14343; SV 1; linear; mRNA; STD; HUM; 919 BP.
XX
AC   D14343;
XX
DT   11-FEB-1993 (Rel. 34, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 9)
XX
DE   Homo sapiens HLA-B61 mRNA, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-919
RA   Lin L.;
RT   ;
RL   Submitted (02-FEB-1993) to the INSDC.
RL   Contact:Ling Lin Japan Red Cross Central Blood Center, Department of
RL   Research; 4-1-31 Hiroo, Shibuya-ku, Tokyo 150, Japan
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.1992.tb02054.x.
RX   PUBMED; 1481202.
RA   Lin L., Watanabe Y., Tokunaga K., Kuwata S., Kohsaka T., Akaza T.;
RT   "A common Japanese haplotype HLA-26-Cw3-B61-DR9-DQ3 carries HLA-B*4002";
RL   Tissue Antigens 40:257-260(1992).
XX
DR   MD5; 40d0362c19c097e1f5118f10c9a73526.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..919
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="YUKI"
FT                   /mol_type="mRNA"
FT                   /sex="female"
FT                   /haplotype="HLA-A26-Cw3-B61-DR9-DQ3"
FT                   /cell_type="lymphocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>919
FT                   /codon_start=1
FT                   /gene="HLA-B61"
FT                   /note="it has the same amino acid sequence as that of
FT                   HLA-B*4002."
FT                   /db_xref="GOA:Q04826"
FT                   /db_xref="H-InvDB:HIT000100536.9"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*40:02:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="PDB:5IEH"
FT                   /db_xref="PDB:5IEK"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q04826"
FT                   /protein_id="BAA03277.1"
FT                   /translation="LWGAVALTETWAGSHSMRYFHTSVSRPGRGEPRFITVGYVDDTLF
FT                   VRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGS
FT                   HTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAR
FT                   VAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYP
FT                   AEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKP
FT                   LTLRWEPSSQSTVPIVGIVAGLAVL"
XX
SQ   Sequence 919 BP; 190 A; 291 C; 304 G; 134 T; 0 other;
     ctctgggggg cagtggccct gaccgagacc tgggctggct cccactccat gaggtatttc        60
     cacacctccg tgtcccggcc cggccgcggg gagccccgct tcatcaccgt gggctacgtg       120
     gacgacacgc tgttcgtgag gttcgacagc gacgccacga gtccgaggaa ggagccgcgg       180
     gcgccatgga tagagcagga ggggccggag tattgggacc gggagacaca gatctccaag       240
     accaacacac agacttaccg agagagcctg cggaacctgc gcggctacta caaccagagc       300
     gaggccgggt ctcacaccct ccagagcatg tacggctgcg acgtggggcc ggacgggcgc       360
     ctcctccgcg ggcataacca gtacgcctac gacggcaagg attacatcgc cctgaacgag       420
     gacctgcgct cctggaccgc cgcggacacg gcggctcaga tcacccagcg caagtgggag       480
     gcggcccgtg tggcggagca gctgagagcc tacctggagg gcgagtgcgt ggagtggctc       540
     cgcagatacc tggagaacgg gaaggagacg ctgcagcgcg cggacccccc aaagacacac       600
     gtgacccacc accccatctc tgaccatgag gccaccctga ggtgctgggc cctgggcttc       660
     taccctgcgg agatcacact gacctggcag cgggatggcg aggaccaaac tcaggacact       720
     gagcttgtgg agaccagacc agcaggagat agaaccttcc agaagtgggc agctgtggtg       780
     gtgccttctg gagaagagca gagatacaca tgccatgtac agcatgaggg gctgccgaag       840
     cccctcaccc tgagatggga gccgtcttcc cagtccaccg tccccatcgt gggcattgtt       900
     gctggcctgg ctgtcctag                                                    919
//