
ID   CP000725; SV 1; circular; genomic DNA; STD; PRO; 2196662 BP.
AC   CP000725;
PR   Project:PRJNA66;
DT   12-SEP-2007 (Rel. 93, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 8)
DE   Streptococcus gordonii str. Challis substr. CH1, complete genome.
KW   .
OS   Streptococcus gordonii str. Challis substr. CH1
OC   Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae;
OC   Streptococcus.
RN   [1]
RP   1-2196662
RX   DOI; 10.1128/JB.01023-07.
RX   PUBMED; 17720781.
RA   Vickerman M.M., Iobst S., Jesionowski A.M., Gill S.R.;
RT   "Genome-wide transcriptional changes in Streptococcus gordonii in response
RT   to competence signaling peptide";
RL   J. Bacteriol. 189(21):7799-7807(2007).
RN   [2]
RP   1-2196662
RA   Gill S.;
RT   ;
RL   Submitted (15-JUN-2007) to the INSDC.
RL   The Institute for Genomic Research, 9712 Medical Center Dr, Rockville, MD
RL   20850, USA
DR   MD5; faaf63fbd671f68177f32d3007e2ce90.
DR   BioSample; SAMN02603977.
DR   EnsemblGenomes-Gn; EBG00001156739.
DR   EnsemblGenomes-Gn; EBG00001156740.
DR   EnsemblGenomes-Gn; EBG00001156741.
DR   EnsemblGenomes-Gn; EBG00001156742.
DR   EnsemblGenomes-Gn; EBG00001156743.
DR   EnsemblGenomes-Gn; EBG00001156744.
DR   EnsemblGenomes-Gn; EBG00001156745.
DR   EnsemblGenomes-Gn; EBG00001156746.
DR   EnsemblGenomes-Gn; EBG00001156747.
DR   EnsemblGenomes-Gn; EBG00001156748.
DR   EnsemblGenomes-Gn; EBG00001156749.
DR   EnsemblGenomes-Gn; EBG00001156750.
DR   EnsemblGenomes-Gn; EBG00001156751.
DR   EnsemblGenomes-Gn; EBG00001156752.
DR   EnsemblGenomes-Gn; EBG00001156753.
DR   EnsemblGenomes-Gn; EBG00001156754.
DR   EnsemblGenomes-Gn; EBG00001156755.
DR   EnsemblGenomes-Gn; EBG00001156756.
DR   EnsemblGenomes-Gn; EBG00001156757.
DR   EnsemblGenomes-Gn; EBG00001156758.
DR   EnsemblGenomes-Gn; EBG00001156759.
DR   EnsemblGenomes-Gn; EBG00001156760.
DR   EnsemblGenomes-Gn; EBG00001156761.
DR   EnsemblGenomes-Gn; EBG00001156762.
DR   EnsemblGenomes-Gn; EBG00001156763.
DR   EnsemblGenomes-Gn; EBG00001156764.
DR   EnsemblGenomes-Gn; EBG00001156765.
DR   EnsemblGenomes-Gn; EBG00001156766.
DR   EnsemblGenomes-Gn; EBG00001156767.
DR   EnsemblGenomes-Gn; EBG00001156768.
DR   EnsemblGenomes-Gn; EBG00001156769.
DR   EnsemblGenomes-Gn; EBG00001156770.
DR   EnsemblGenomes-Gn; EBG00001156771.
DR   EnsemblGenomes-Gn; EBG00001156772.
DR   EnsemblGenomes-Gn; EBG00001156773.
DR   EnsemblGenomes-Gn; EBG00001156774.
DR   EnsemblGenomes-Gn; EBG00001156775.
DR   EnsemblGenomes-Gn; EBG00001156776.
DR   EnsemblGenomes-Gn; EBG00001156777.
DR   EnsemblGenomes-Gn; EBG00001156778.
DR   EnsemblGenomes-Gn; EBG00001156779.
DR   EnsemblGenomes-Gn; EBG00001156780.
DR   EnsemblGenomes-Gn; EBG00001156781.
DR   EnsemblGenomes-Gn; EBG00001156782.
DR   EnsemblGenomes-Gn; EBG00001156783.
DR   EnsemblGenomes-Gn; EBG00001156784.
DR   EnsemblGenomes-Gn; EBG00001156785.
DR   EnsemblGenomes-Gn; EBG00001156786.
DR   EnsemblGenomes-Gn; EBG00001156787.
DR   EnsemblGenomes-Gn; EBG00001156788.
DR   EnsemblGenomes-Gn; EBG00001156789.
DR   EnsemblGenomes-Gn; EBG00001156790.
DR   EnsemblGenomes-Gn; EBG00001156791.
DR   EnsemblGenomes-Gn; EBG00001156792.
DR   EnsemblGenomes-Gn; EBG00001156793.
DR   EnsemblGenomes-Gn; EBG00001156794.
DR   EnsemblGenomes-Gn; EBG00001156795.
DR   EnsemblGenomes-Gn; EBG00001156796.
DR   EnsemblGenomes-Gn; EBG00001156797.
DR   EnsemblGenomes-Gn; EBG00001156798.
DR   EnsemblGenomes-Gn; EBG00001156799.
DR   EnsemblGenomes-Gn; EBG00001156800.
DR   EnsemblGenomes-Gn; EBG00001156801.
DR   EnsemblGenomes-Gn; EBG00001156802.
DR   EnsemblGenomes-Gn; EBG00001156803.
DR   EnsemblGenomes-Gn; EBG00001156804.
DR   EnsemblGenomes-Gn; EBG00001156805.
DR   EnsemblGenomes-Gn; EBG00001156806.
DR   EnsemblGenomes-Gn; EBG00001156807.
DR   EnsemblGenomes-Gn; EBG00001156808.
DR   EnsemblGenomes-Gn; EBG00001156809.
DR   EnsemblGenomes-Gn; EBG00001156810.
DR   EnsemblGenomes-Gn; EBG00001156811.
DR   EnsemblGenomes-Gn; EBG00001156812.
DR   EnsemblGenomes-Gn; EBG00001156813.
DR   EnsemblGenomes-Gn; EBG00001156814.
DR   EnsemblGenomes-Gn; EBG00001156815.
DR   EnsemblGenomes-Gn; EBG00001156816.
DR   EnsemblGenomes-Gn; EBG00001156817.
DR   EnsemblGenomes-Gn; EBG00001156818.
DR   EnsemblGenomes-Gn; EBG00001156819.
DR   EnsemblGenomes-Gn; EBG00001156820.
DR   EnsemblGenomes-Gn; EBG00001156821.
DR   EnsemblGenomes-Gn; EBG00001156822.
DR   EnsemblGenomes-Gn; EBG00001156823.
DR   EnsemblGenomes-Gn; EBG00001156824.
DR   EnsemblGenomes-Gn; SGO_0195.
DR   EnsemblGenomes-Gn; SGO_0611.
DR   EnsemblGenomes-Gn; SGO_0612.
DR   EnsemblGenomes-Gn; SGO_0613.
DR   EnsemblGenomes-Gn; SGO_0614.
DR   EnsemblGenomes-Gn; SGO_0615.
DR   EnsemblGenomes-Gn; SGO_0616.
DR   EnsemblGenomes-Gn; SGO_0617.
DR   EnsemblGenomes-Gn; SGO_0618.
DR   EnsemblGenomes-Gn; SGO_0619.
DR   EnsemblGenomes-Gn; SGO_0620.
DR   EnsemblGenomes-Gn; SGO_0621.
DR   EnsemblGenomes-Gn; SGO_0622.
DR   EnsemblGenomes-Gn; SGO_0623.
DR   EnsemblGenomes-Gn; SGO_0710.
DR   EnsemblGenomes-Gn; SGO_1233.
DR   EnsemblGenomes-Gn; SGO_1235.
DR   EnsemblGenomes-Gn; SGO_1236.
DR   EnsemblGenomes-Gn; SGO_1270.
DR   EnsemblGenomes-Gn; SGO_1382.
DR   EnsemblGenomes-Gn; SGO_1702.
DR   EnsemblGenomes-Gn; SGO_1703.
DR   EnsemblGenomes-Gn; SGO_1704.
DR   EnsemblGenomes-Gn; SGO_1705.
DR   EnsemblGenomes-Gn; SGO_1706.
DR   EnsemblGenomes-Gn; SGO_1741.
DR   EnsemblGenomes-Gn; SGO_1746.
DR   EnsemblGenomes-Gn; SGO_1829.
DR   EnsemblGenomes-Gn; SGO_1941.
DR   EnsemblGenomes-Gn; SGO_1942.
DR   EnsemblGenomes-Gn; SGO_1943.
DR   EnsemblGenomes-Gn; SGO_1944.
DR   EnsemblGenomes-Gn; SGO_1945.
DR   EnsemblGenomes-Gn; SGO_1946.
DR   EnsemblGenomes-Gn; SGO_1947.
DR   EnsemblGenomes-Gn; SGO_1948.
DR   EnsemblGenomes-Gn; SGO_1949.
DR   EnsemblGenomes-Gn; SGO_1950.
DR   EnsemblGenomes-Gn; SGO_1951.
DR   EnsemblGenomes-Gn; SGO_1952.
DR   EnsemblGenomes-Gn; SGO_1953.
DR   EnsemblGenomes-Gn; SGO_1954.
DR   EnsemblGenomes-Gn; SGO_1955.
DR   EnsemblGenomes-Gn; SGO_1956.
DR   EnsemblGenomes-Gn; SGO_2003.
DR   EnsemblGenomes-Gn; SGO_2109.
DR   EnsemblGenomes-Gn; SGO_2110.
DR   EnsemblGenomes-Gn; SGO_2111.
DR   EnsemblGenomes-Gn; SGO_2112.
DR   EnsemblGenomes-Gn; SGO_2113.
DR   EnsemblGenomes-Gn; SGO_2114.
DR   EnsemblGenomes-Gn; SGO_2115.
DR   EnsemblGenomes-Gn; SGO_2116.
DR   EnsemblGenomes-Gn; SGO_2117.
DR   EnsemblGenomes-Gn; SGO_2118.
DR   EnsemblGenomes-Gn; SGO_2119.
DR   EnsemblGenomes-Gn; SGO_2120.
DR   EnsemblGenomes-Gn; SGO_2121.
DR   EnsemblGenomes-Gn; SGO_2122.
DR   EnsemblGenomes-Gn; SGO_2123.
DR   EnsemblGenomes-Gn; SGO_2124.
DR   EnsemblGenomes-Gn; SGO_2125.
DR   EnsemblGenomes-Gn; SGO_2126.
DR   EnsemblGenomes-Gn; SGO_2127.
DR   EnsemblGenomes-Gn; SGO_2128.
DR   EnsemblGenomes-Gn; SGO_2129.
DR   EnsemblGenomes-Gn; SGO_2131.
DR   EnsemblGenomes-Gn; SGO_2132.
DR   EnsemblGenomes-Gn; SGO_2143.
DR   EnsemblGenomes-Gn; SGO_2144.
DR   EnsemblGenomes-Gn; SGO_2148.
DR   EnsemblGenomes-Tr; EBT00001745391.
DR   EnsemblGenomes-Tr; EBT00001745392.
DR   EnsemblGenomes-Tr; EBT00001745393.
DR   EnsemblGenomes-Tr; EBT00001745394.
DR   EnsemblGenomes-Tr; EBT00001745395.
DR   EnsemblGenomes-Tr; EBT00001745396.
DR   EnsemblGenomes-Tr; EBT00001745397.
DR   EnsemblGenomes-Tr; EBT00001745398.
DR   EnsemblGenomes-Tr; EBT00001745399.
DR   EnsemblGenomes-Tr; EBT00001745400.
DR   EnsemblGenomes-Tr; EBT00001745401.
DR   EnsemblGenomes-Tr; EBT00001745402.
DR   EnsemblGenomes-Tr; EBT00001745403.
DR   EnsemblGenomes-Tr; EBT00001745404.
DR   EnsemblGenomes-Tr; EBT00001745405.
DR   EnsemblGenomes-Tr; EBT00001745406.
DR   EnsemblGenomes-Tr; EBT00001745407.
DR   EnsemblGenomes-Tr; EBT00001745408.
DR   EnsemblGenomes-Tr; EBT00001745409.
DR   EnsemblGenomes-Tr; EBT00001745410.
DR   EnsemblGenomes-Tr; EBT00001745411.
DR   EnsemblGenomes-Tr; EBT00001745412.
DR   EnsemblGenomes-Tr; EBT00001745413.
DR   EnsemblGenomes-Tr; EBT00001745414.
DR   EnsemblGenomes-Tr; EBT00001745415.
DR   EnsemblGenomes-Tr; EBT00001745416.
DR   EnsemblGenomes-Tr; EBT00001745417.
DR   EnsemblGenomes-Tr; EBT00001745418.
DR   EnsemblGenomes-Tr; EBT00001745419.
DR   EnsemblGenomes-Tr; EBT00001745420.
DR   EnsemblGenomes-Tr; EBT00001745421.
DR   EnsemblGenomes-Tr; EBT00001745422.
DR   EnsemblGenomes-Tr; EBT00001745423.
DR   EnsemblGenomes-Tr; EBT00001745424.
DR   EnsemblGenomes-Tr; EBT00001745425.
DR   EnsemblGenomes-Tr; EBT00001745426.
DR   EnsemblGenomes-Tr; EBT00001745427.
DR   EnsemblGenomes-Tr; EBT00001745428.
DR   EnsemblGenomes-Tr; EBT00001745429.
DR   EnsemblGenomes-Tr; EBT00001745430.
DR   EnsemblGenomes-Tr; EBT00001745431.
DR   EnsemblGenomes-Tr; EBT00001745432.
DR   EnsemblGenomes-Tr; EBT00001745433.
DR   EnsemblGenomes-Tr; EBT00001745434.
DR   EnsemblGenomes-Tr; EBT00001745435.
DR   EnsemblGenomes-Tr; EBT00001745436.
DR   EnsemblGenomes-Tr; EBT00001745437.
DR   EnsemblGenomes-Tr; EBT00001745438.
DR   EnsemblGenomes-Tr; EBT00001745439.
DR   EnsemblGenomes-Tr; EBT00001745440.
DR   EnsemblGenomes-Tr; EBT00001745441.
DR   EnsemblGenomes-Tr; EBT00001745442.
DR   EnsemblGenomes-Tr; EBT00001745443.
DR   EnsemblGenomes-Tr; EBT00001745444.
DR   EnsemblGenomes-Tr; EBT00001745445.
DR   EnsemblGenomes-Tr; EBT00001745446.
DR   EnsemblGenomes-Tr; EBT00001745447.
DR   EnsemblGenomes-Tr; EBT00001745448.
DR   EnsemblGenomes-Tr; EBT00001745449.
DR   EnsemblGenomes-Tr; EBT00001745450.
DR   EnsemblGenomes-Tr; EBT00001745451.
DR   EnsemblGenomes-Tr; EBT00001745452.
DR   EnsemblGenomes-Tr; EBT00001745453.
DR   EnsemblGenomes-Tr; EBT00001745454.
DR   EnsemblGenomes-Tr; EBT00001745455.
DR   EnsemblGenomes-Tr; EBT00001745456.
DR   EnsemblGenomes-Tr; EBT00001745457.
DR   EnsemblGenomes-Tr; EBT00001745458.
DR   EnsemblGenomes-Tr; EBT00001745459.
DR   EnsemblGenomes-Tr; EBT00001745460.
DR   EnsemblGenomes-Tr; EBT00001745461.
DR   EnsemblGenomes-Tr; EBT00001745462.
DR   EnsemblGenomes-Tr; EBT00001745463.
DR   EnsemblGenomes-Tr; EBT00001745464.
DR   EnsemblGenomes-Tr; EBT00001745465.
DR   EnsemblGenomes-Tr; EBT00001745466.
DR   EnsemblGenomes-Tr; EBT00001745467.
DR   EnsemblGenomes-Tr; EBT00001745468.
DR   EnsemblGenomes-Tr; EBT00001745469.
DR   EnsemblGenomes-Tr; EBT00001745470.
DR   EnsemblGenomes-Tr; EBT00001745471.
DR   EnsemblGenomes-Tr; EBT00001745472.
DR   EnsemblGenomes-Tr; EBT00001745473.
DR   EnsemblGenomes-Tr; EBT00001745474.
DR   EnsemblGenomes-Tr; EBT00001745475.
DR   EnsemblGenomes-Tr; EBT00001745476.
DR   EnsemblGenomes-Tr; SGO_0195-1.
DR   EnsemblGenomes-Tr; SGO_0611-1.
DR   EnsemblGenomes-Tr; SGO_0612-1.
DR   EnsemblGenomes-Tr; SGO_0613-1.
DR   EnsemblGenomes-Tr; SGO_0614-1.
DR   EnsemblGenomes-Tr; SGO_0615-1.
DR   EnsemblGenomes-Tr; SGO_0616-1.
DR   EnsemblGenomes-Tr; SGO_0617-1.
DR   EnsemblGenomes-Tr; SGO_0618-1.
DR   EnsemblGenomes-Tr; SGO_0619-1.
DR   EnsemblGenomes-Tr; SGO_0620-1.
DR   EnsemblGenomes-Tr; SGO_0621-1.
DR   EnsemblGenomes-Tr; SGO_0622-1.
DR   EnsemblGenomes-Tr; SGO_0623-1.
DR   EnsemblGenomes-Tr; SGO_0710-1.
DR   EnsemblGenomes-Tr; SGO_1233-1.
DR   EnsemblGenomes-Tr; SGO_1235-1.
DR   EnsemblGenomes-Tr; SGO_1236-1.
DR   EnsemblGenomes-Tr; SGO_1270-1.
DR   EnsemblGenomes-Tr; SGO_1382-1.
DR   EnsemblGenomes-Tr; SGO_1702-1.
DR   EnsemblGenomes-Tr; SGO_1703-1.
DR   EnsemblGenomes-Tr; SGO_1704-1.
DR   EnsemblGenomes-Tr; SGO_1705-1.
DR   EnsemblGenomes-Tr; SGO_1706-1.
DR   EnsemblGenomes-Tr; SGO_1741-1.
DR   EnsemblGenomes-Tr; SGO_1746-1.
DR   EnsemblGenomes-Tr; SGO_1829-1.
DR   EnsemblGenomes-Tr; SGO_1941-1.
DR   EnsemblGenomes-Tr; SGO_1942-1.
DR   EnsemblGenomes-Tr; SGO_1943-1.
DR   EnsemblGenomes-Tr; SGO_1944-1.
DR   EnsemblGenomes-Tr; SGO_1945-1.
DR   EnsemblGenomes-Tr; SGO_1946-1.
DR   EnsemblGenomes-Tr; SGO_1947-1.
DR   EnsemblGenomes-Tr; SGO_1948-1.
DR   EnsemblGenomes-Tr; SGO_1949-1.
DR   EnsemblGenomes-Tr; SGO_1950-1.
DR   EnsemblGenomes-Tr; SGO_1951-1.
DR   EnsemblGenomes-Tr; SGO_1952-1.
DR   EnsemblGenomes-Tr; SGO_1953-1.
DR   EnsemblGenomes-Tr; SGO_1954-1.
DR   EnsemblGenomes-Tr; SGO_1955-1.
DR   EnsemblGenomes-Tr; SGO_1956-1.
DR   EnsemblGenomes-Tr; SGO_2003-1.
DR   EnsemblGenomes-Tr; SGO_2109-1.
DR   EnsemblGenomes-Tr; SGO_2110-1.
DR   EnsemblGenomes-Tr; SGO_2111-1.
DR   EnsemblGenomes-Tr; SGO_2112-1.
DR   EnsemblGenomes-Tr; SGO_2113-1.
DR   EnsemblGenomes-Tr; SGO_2114-1.
DR   EnsemblGenomes-Tr; SGO_2115-1.
DR   EnsemblGenomes-Tr; SGO_2116-1.
DR   EnsemblGenomes-Tr; SGO_2117-1.
DR   EnsemblGenomes-Tr; SGO_2118-1.
DR   EnsemblGenomes-Tr; SGO_2119-1.
DR   EnsemblGenomes-Tr; SGO_2120-1.
DR   EnsemblGenomes-Tr; SGO_2121-1.
DR   EnsemblGenomes-Tr; SGO_2122-1.
DR   EnsemblGenomes-Tr; SGO_2123-1.
DR   EnsemblGenomes-Tr; SGO_2124-1.
DR   EnsemblGenomes-Tr; SGO_2125-1.
DR   EnsemblGenomes-Tr; SGO_2126-1.
DR   EnsemblGenomes-Tr; SGO_2127-1.
DR   EnsemblGenomes-Tr; SGO_2128-1.
DR   EnsemblGenomes-Tr; SGO_2129-1.
DR   EnsemblGenomes-Tr; SGO_2131-1.
DR   EnsemblGenomes-Tr; SGO_2132-1.
DR   EnsemblGenomes-Tr; SGO_2143-1.
DR   EnsemblGenomes-Tr; SGO_2144-1.
DR   EnsemblGenomes-Tr; SGO_2148-1.
DR   EuropePMC; PMC2168715; 17720781.
DR   EuropePMC; PMC2546850; 18678669.
DR   EuropePMC; PMC2657157; 19175920.
DR   EuropePMC; PMC2772543; 19703977.
DR   EuropePMC; PMC2798181; 19884334.
DR   EuropePMC; PMC2863574; 20233933.
DR   EuropePMC; PMC3043496; 21147955.
DR   EuropePMC; PMC3091779; 21106082.
DR   EuropePMC; PMC3173452; 21824414.
DR   EuropePMC; PMC3298122; 22247133.
DR   EuropePMC; PMC3327732; 22431892.
DR   EuropePMC; PMC3390759; 22759313.
DR   EuropePMC; PMC3522854; 23228255.
DR   EuropePMC; PMC4757518; 26280461.
DR   EuropePMC; PMC5069739; 27822519.
DR   EuropePMC; PMC5076819; 27551046.
DR   EuropePMC; PMC5513104; 28705175.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00555; L13_leader.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF00559; L21_leader.
DR   RFAM; RF01054; preQ1-II.
DR   RFAM; RF01065; 23S-methyl.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01708; L17DE.
DR   RFAM; RF01709; Lacto-rpoB.
DR   RFAM; RF01732; asd.
DR   RFAM; RF01764; yjdF.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000725.
DR   SILVA-SSU; CP000725.
DR   StrainInfo; 120832; 0.
DR   PubMed; 17720781.
CC   Streptococcus gordonii str. Challis substr. CH1 genomic DNA or
CC   bacterial culture is available from Steven R. Gill at
CC   srgill@buffalo.edu.
FH   Key             Location/Qualifiers
FT   source          1..2196662
FT                   /organism="Streptococcus gordonii str. Challis substr. CH1"
FT                   /strain="Challis"
FT                   /sub_strain="CH1"
FT                   /mol_type="genomic DNA"
FT                   /note="strain coidentity: CH1 = DL1 = V288 = ATCC 35105"
FT                   /db_xref="taxon:467705"
FT   gene            166..1518
FT                   /gene="dnaA"
FT                   /locus_tag="SGO_0001"
FT   CDS             166..1518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="SGO_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="identified by match to protein family HMM PF00308;
FT                   match to protein family HMM PF08299; match to protein
FT                   family HMM TIGR00362"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09168"
FT                   /db_xref="GOA:A8AU63"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8AU63"
FT                   /protein_id="ABV09168.1"
FT   gene            1674..2810
FT                   /gene="dnaN"
FT                   /locus_tag="SGO_0002"
FT   CDS             1674..2810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="SGO_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00712;
FT                   match to protein family HMM PF02767; match to protein
FT                   family HMM PF02768; match to protein family HMM TIGR00663"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10994"
FT                   /db_xref="GOA:A8AU64"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A8AU64"
FT                   /protein_id="ABV10994.1"
FT   gene            2810..3013
FT                   /locus_tag="SGO_0003"
FT   CDS             2810..3013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0003"
FT                   /product="Bacterial protein of unknown function (DUF951)
FT                   superfamily"
FT                   /note="identified by match to protein family HMM PF06107"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10665"
FT                   /db_xref="InterPro:IPR009296"
FT                   /db_xref="UniProtKB/TrEMBL:A8AU65"
FT                   /protein_id="ABV10665.1"
FT   gene            complement(3023..3541)
FT                   /locus_tag="SGO_0004"
FT   CDS             complement(3023..3541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0004"
FT                   /product="putative lipoprotein"
FT                   /note="identified by match to protein family HMM PF06998"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09729"
FT                   /db_xref="InterPro:IPR009736"
FT                   /db_xref="InterPro:IPR036699"
FT                   /db_xref="UniProtKB/TrEMBL:A8AU66"
FT                   /protein_id="ABV09729.1"
FT                   NGKFEELKK"
FT   gene            complement(3582..6176)
FT                   /locus_tag="SGO_0005"
FT   CDS             complement(3582..6176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0005"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10263"
FT                   /db_xref="GOA:A8AU67"
FT                   /db_xref="InterPro:IPR018580"
FT                   /db_xref="UniProtKB/TrEMBL:A8AU67"
FT                   /protein_id="ABV10263.1"
FT   gene            complement(6216..7838)
FT                   /locus_tag="SGO_0006"
FT   CDS             complement(6216..7838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0006"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10060"
FT                   /db_xref="GOA:A8AU68"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:A8AU68"
FT                   /protein_id="ABV10060.1"
FT   gene            8068..9090
FT                   /gene="trpS"
FT                   /locus_tag="SGO_0007"
FT   CDS             8068..9090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpS"
FT                   /locus_tag="SGO_0007"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00579;
FT                   match to protein family HMM TIGR00233"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09580"
FT                   /db_xref="GOA:A8AU69"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:A8AU69"
FT                   /protein_id="ABV09580.1"
FT                   "
FT   gene            9195..10676
FT                   /locus_tag="SGO_0008"
FT   CDS             9195..10676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0008"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00478;
FT                   match to protein family HMM PF00571; match to protein
FT                   family HMM PF03060; match to protein family HMM TIGR01302"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10065"
FT                   /db_xref="GOA:A8AU70"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:A8AU70"
FT                   /protein_id="ABV10065.1"
FT   gene            complement(10780..11865)
FT                   /gene="recF"
FT                   /locus_tag="SGO_0009"
FT   CDS             complement(10780..11865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="SGO_0009"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="identified by similarity to SP:P49999; match to
FT                   protein family HMM PF02463; match to protein family HMM
FT                   TIGR00611"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09421"
FT                   /db_xref="GOA:A8AU71"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AU71"
FT                   /protein_id="ABV09421.1"
FT   gene            complement(11867..12259)
FT                   /locus_tag="SGO_0010"
FT   CDS             complement(11867..12259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0010"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM TIGR02988"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11029"
FT                   /db_xref="GOA:A8AU72"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014330"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A8AU72"
FT                   /protein_id="ABV11029.1"
FT   gene            12414..13661
FT                   /locus_tag="SGO_0011"
FT   CDS             12414..13661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0011"
FT                   /product="proteinase, M16 family"
FT                   /note="identified by match to protein family HMM PF05193"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10476"
FT                   /db_xref="GOA:A8AU73"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="UniProtKB/TrEMBL:A8AU73"
FT                   /protein_id="ABV10476.1"
FT                   AANTLKLQAMYFMEGK"
FT   gene            13661..14956
FT                   /gene="mpp"
FT                   /locus_tag="SGO_0012"
FT   CDS             13661..14956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mpp"
FT                   /locus_tag="SGO_0012"
FT                   /product="peptidase, M16 family"
FT                   /EC_number="3.4.-.-"
FT                   /note="identified by match to protein family HMM PF00675;
FT                   match to protein family HMM PF05193"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10368"
FT                   /db_xref="GOA:A8AU74"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:A8AU74"
FT                   /protein_id="ABV10368.1"
FT   gene            15203..16033
FT                   /locus_tag="SGO_0013"
FT   CDS             15203..16033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0013"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09778"
FT                   /db_xref="GOA:A8AU75"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A8AU75"
FT                   /protein_id="ABV09778.1"
FT   gene            16042..16581
FT                   /gene="pgsA"
FT                   /locus_tag="SGO_0014"
FT   CDS             16042..16581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgsA"
FT                   /locus_tag="SGO_0014"
FT                   /product="CDP-diacylglycerol--glycerol-3-phosphate
FT                   3-phosphatidyltransferase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01066;
FT                   match to protein family HMM TIGR00560"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09570"
FT                   /db_xref="GOA:A8AU76"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004570"
FT                   /db_xref="UniProtKB/TrEMBL:A8AU76"
FT                   /protein_id="ABV09570.1"
FT                   YDYFKGSAYLFKDTFK"
FT   gene            16585..17409
FT                   /locus_tag="SGO_0015"
FT   CDS             16585..17409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0015"
FT                   /product="ABC transporter (ATP-binding protein)"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10394"
FT                   /db_xref="GOA:A8AU77"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030947"
FT                   /db_xref="UniProtKB/TrEMBL:A8AU77"
FT                   /protein_id="ABV10394.1"
FT   gene            17394..18233
FT                   /gene="cbiO"
FT                   /locus_tag="SGO_0016"
FT   CDS             17394..18233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiO"
FT                   /locus_tag="SGO_0016"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09639"
FT                   /db_xref="GOA:A8AU78"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030946"
FT                   /db_xref="UniProtKB/TrEMBL:A8AU78"
FT                   /protein_id="ABV09639.1"
FT   gene            18226..19020
FT                   /locus_tag="SGO_0017"
FT   CDS             18226..19020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0017"
FT                   /product="ABC-type putative cobalt transport system,
FT                   permease"
FT                   /note="identified by match to protein family HMM PF02361"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10080"
FT                   /db_xref="GOA:A8AU79"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR024919"
FT                   /db_xref="UniProtKB/TrEMBL:A8AU79"
FT                   /protein_id="ABV10080.1"
FT   gene            19222..19836
FT                   /locus_tag="SGO_0018"
FT   CDS             19222..19836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0018"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF01476;
FT                   match to protein family HMM PF06737"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10680"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A8AU80"
FT                   /protein_id="ABV10680.1"
FT   gene            complement(19913..20785)
FT                   /gene="sdhA"
FT                   /locus_tag="SGO_0019"
FT   CDS             complement(19913..20785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhA"
FT                   /locus_tag="SGO_0019"
FT                   /product="L-serine dehydratase, iron-sulfur-dependent,
FT                   alpha subunit"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF03313;
FT                   match to protein family HMM TIGR00718"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10058"
FT                   /db_xref="GOA:A8AU81"
FT                   /db_xref="InterPro:IPR004642"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="UniProtKB/TrEMBL:A8AU81"
FT                   /protein_id="ABV10058.1"
FT                   RLSKEIFGE"
FT   gene            complement(20794..21465)
FT                   /gene="sdhB"
FT                   /locus_tag="SGO_0020"
FT   CDS             complement(20794..21465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhB"
FT                   /locus_tag="SGO_0020"
FT                   /product="L-serine dehydratase, iron-sulfur-dependent, beta
FT                   subunit"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01842;
FT                   match to protein family HMM PF03315; match to protein
FT                   family HMM TIGR00719"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10799"
FT                   /db_xref="GOA:A8AU82"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004643"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="UniProtKB/TrEMBL:A8AU82"
FT                   /protein_id="ABV10799.1"
FT                   K"
FT   gene            21791..22354
FT                   /locus_tag="SGO_0021"
FT   CDS             21791..22354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0021"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF01476"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10227"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A8AU83"
FT                   /protein_id="ABV10227.1"
FT   gene            22565..23686
FT                   /gene="trmU"
FT                   /locus_tag="SGO_0022"
FT   CDS             22565..23686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmU"
FT                   /locus_tag="SGO_0022"
FT                   /product="tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF03054;
FT                   match to protein family HMM TIGR00420"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10379"
FT                   /db_xref="GOA:A8AU84"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AU84"
FT                   /protein_id="ABV10379.1"
FT   gene            23706..24320
FT                   /locus_tag="SGO_0023"
FT   CDS             23706..24320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0023"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF01914;
FT                   match to protein family HMM TIGR00427"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09764"
FT                   /db_xref="GOA:A8AU85"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:A8AU85"
FT                   /protein_id="ABV09764.1"
FT   gene            24391..24486
FT                   /locus_tag="SGO_0024"
FT   CDS             24391..24486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0024"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10177"
FT                   /db_xref="UniProtKB/TrEMBL:A8AU86"
FT                   /protein_id="ABV10177.1"
FT                   /translation="MLQAFLSCTSGDLAFFGEKKNEGKRNVTQFY"
FT   gene            24467..26386
FT                   /gene="gidA"
FT                   /locus_tag="SGO_0025"
FT   CDS             24467..26386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidA"
FT                   /locus_tag="SGO_0025"
FT                   /product="glucose inhibited division protein A"
FT                   /note="identified by match to protein family HMM PF01134;
FT                   match to protein family HMM TIGR00136"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09461"
FT                   /db_xref="GOA:A8AU87"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AU87"
FT                   /protein_id="ABV09461.1"
FT                   QNHV"
FT   gene            26728..28707
FT                   /locus_tag="SGO_0026"
FT   CDS             26728..28707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0026"
FT                   /product="DHH subfamily 1 protein"
FT                   /note="identified by match to protein family HMM PF01368;
FT                   match to protein family HMM PF02272"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09903"
FT                   /db_xref="GOA:A8AU88"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR014528"
FT                   /db_xref="UniProtKB/TrEMBL:A8AU88"
FT                   /protein_id="ABV09903.1"
FT   gene            28704..29156
FT                   /gene="rplI"
FT                   /locus_tag="SGO_0027"
FT   CDS             28704..29156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplI"
FT                   /locus_tag="SGO_0027"
FT                   /product="ribosomal protein L9"
FT                   /note="identified by match to protein family HMM PF01281;
FT                   match to protein family HMM PF03948; match to protein
FT                   family HMM TIGR00158"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09728"
FT                   /db_xref="GOA:A8AU89"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AU89"
FT                   /protein_id="ABV09728.1"
FT   gene            29183..30538
FT                   /gene="dnaC"
FT                   /locus_tag="SGO_0028"
FT   CDS             29183..30538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaC"
FT                   /locus_tag="SGO_0028"
FT                   /product="replicative DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00772;
FT                   match to protein family HMM PF03796; match to protein
FT                   family HMM TIGR00665"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09162"
FT                   /db_xref="GOA:A8AU90"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:A8AU90"
FT                   /protein_id="ABV09162.1"
FT   gene            30540..30830
FT                   /locus_tag="SGO_0029"
FT   CDS             30540..30830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0029"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06257"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10632"
FT                   /db_xref="InterPro:IPR009366"
FT                   /db_xref="UniProtKB/TrEMBL:A8AU91"
FT                   /protein_id="ABV10632.1"
FT   gene            30955..32142
FT                   /gene="aspB"
FT                   /locus_tag="SGO_0030"
FT   CDS             30955..32142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspB"
FT                   /locus_tag="SGO_0030"
FT                   /product="aspartate transaminase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00155"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10057"
FT                   /db_xref="GOA:A8AU92"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A8AU92"
FT                   /protein_id="ABV10057.1"
FT   gene            32120..32902
FT                   /gene="recO"
FT                   /locus_tag="SGO_0031"
FT   CDS             32120..32902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recO"
FT                   /locus_tag="SGO_0031"
FT                   /product="DNA repair protein RecO"
FT                   /note="identified by match to protein family HMM PF02565;
FT                   match to protein family HMM TIGR00613"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10039"
FT                   /db_xref="GOA:A8AU93"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AU93"
FT                   /protein_id="ABV10039.1"
FT   gene            32899..33900
FT                   /gene="plsX"
FT                   /locus_tag="SGO_0032"
FT   CDS             32899..33900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsX"
FT                   /locus_tag="SGO_0032"
FT                   /product="fatty acid/phospholipid synthesis protein PlsX"
FT                   /note="identified by match to protein family HMM PF02504;
FT                   match to protein family HMM TIGR00182"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09549"
FT                   /db_xref="GOA:A8AU94"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AU94"
FT                   /protein_id="ABV09549.1"
FT   gene            33897..34136
FT                   /gene="acpP"
FT                   /locus_tag="SGO_0033"
FT   CDS             33897..34136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpP"
FT                   /locus_tag="SGO_0033"
FT                   /product="acyl carrier protein"
FT                   /note="identified by match to protein family HMM PF00550"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10942"
FT                   /db_xref="GOA:A8AU95"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:A8AU95"
FT                   /protein_id="ABV10942.1"
FT   gene            34289..34996
FT                   /gene="purC"
FT                   /locus_tag="SGO_0034"
FT   CDS             34289..34996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purC"
FT                   /locus_tag="SGO_0034"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01259;
FT                   match to protein family HMM TIGR00081"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10503"
FT                   /db_xref="GOA:A8AU96"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AU96"
FT                   /protein_id="ABV10503.1"
FT                   VYQVVWEKLQAIK"
FT   gene            35015..38758
FT                   /locus_tag="SGO_0035"
FT   CDS             35015..38758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0035"
FT                   /product="phosphoribosylformylglycinamidine synthase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01965;
FT                   match to protein family HMM PF02769; match to protein
FT                   family HMM TIGR01857"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11112"
FT                   /db_xref="GOA:A8AU97"
FT                   /db_xref="InterPro:IPR010141"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A8AU97"
FT                   /protein_id="ABV11112.1"
FT   gene            38842..40284
FT                   /gene="purF"
FT                   /locus_tag="SGO_0036"
FT   CDS             38842..40284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purF"
FT                   /locus_tag="SGO_0036"
FT                   /product="amidophosphoribosyltransferase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM PF00310; match to protein
FT                   family HMM TIGR01134"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09497"
FT                   /db_xref="GOA:A8AU98"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:A8AU98"
FT                   /protein_id="ABV09497.1"
FT   gene            40327..41349
FT                   /gene="purM"
FT                   /locus_tag="SGO_0037"
FT   CDS             40327..41349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purM"
FT                   /locus_tag="SGO_0037"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00586;
FT                   match to protein family HMM PF02769; match to protein
FT                   family HMM TIGR00878"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10222"
FT                   /db_xref="GOA:A8AU99"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AU99"
FT                   /protein_id="ABV10222.1"
FT                   "
FT   gene            41346..41897
FT                   /gene="purN"
FT                   /locus_tag="SGO_0038"
FT   CDS             41346..41897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purN"
FT                   /locus_tag="SGO_0038"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00551;
FT                   match to protein family HMM TIGR00639"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09279"
FT                   /db_xref="GOA:A8AUA0"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUA0"
FT                   /protein_id="ABV09279.1"
FT   gene            41910..42608
FT                   /locus_tag="SGO_0039"
FT   CDS             41910..42608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0039"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09734"
FT                   /db_xref="GOA:A8AUA1"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUA1"
FT                   /protein_id="ABV09734.1"
FT                   KYTLLEKEQK"
FT   gene            42605..44152
FT                   /gene="purH"
FT                   /locus_tag="SGO_0040"
FT   CDS             42605..44152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="SGO_0040"
FT                   /product="bifunctional purine biosynthesis protein PurH"
FT                   /note="identified by match to protein family HMM PF01808;
FT                   match to protein family HMM PF02142; match to protein
FT                   family HMM TIGR00355"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10508"
FT                   /db_xref="GOA:A8AUA2"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AUA2"
FT                   /protein_id="ABV10508.1"
FT   gene            44149..44250
FT                   /locus_tag="SGO_0041"
FT   CDS             44149..44250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0041"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09588"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUA3"
FT                   /protein_id="ABV09588.1"
FT   gene            complement(44481..45197)
FT                   /locus_tag="SGO_0042"
FT   CDS             complement(44481..45197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0042"
FT                   /product="transcription regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF07702"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10047"
FT                   /db_xref="GOA:A8AUA4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUA4"
FT                   /protein_id="ABV10047.1"
FT                   RGDFYKIKFIASDKSR"
FT   gene            45352..47130
FT                   /locus_tag="SGO_0043"
FT   CDS             45352..47130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0043"
FT                   /product="beta-galactosidase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01301;
FT                   match to protein family HMM PF02449"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09454"
FT                   /db_xref="GOA:A8AUA5"
FT                   /db_xref="InterPro:IPR001944"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR026283"
FT                   /db_xref="InterPro:IPR031330"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUA5"
FT                   /protein_id="ABV09454.1"
FT                   HLVNQPTFKNIKGENL"
FT   gene            47127..47603
FT                   /locus_tag="SGO_0044"
FT   CDS             47127..47603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0044"
FT                   /product="PTS system, IIB component"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF03830"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09912"
FT                   /db_xref="GOA:A8AUA6"
FT                   /db_xref="InterPro:IPR004720"
FT                   /db_xref="InterPro:IPR036667"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUA6"
FT                   /protein_id="ABV09912.1"
FT   gene            47630..48544
FT                   /locus_tag="SGO_0045"
FT   CDS             47630..48544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0045"
FT                   /product="PTS system, IIC component"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF03609"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09281"
FT                   /db_xref="GOA:A8AUA7"
FT                   /db_xref="InterPro:IPR004700"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUA7"
FT                   /protein_id="ABV09281.1"
FT   gene            48531..49352
FT                   /locus_tag="SGO_0046"
FT   CDS             48531..49352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0046"
FT                   /product="PTS system, IID component"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF03613"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09670"
FT                   /db_xref="GOA:A8AUA8"
FT                   /db_xref="InterPro:IPR004704"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUA8"
FT                   /protein_id="ABV09670.1"
FT   gene            49364..49771
FT                   /locus_tag="SGO_0047"
FT   CDS             49364..49771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0047"
FT                   /product="PTS system, IIA component"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF03610"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10686"
FT                   /db_xref="GOA:A8AUA9"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUA9"
FT                   /protein_id="ABV10686.1"
FT   gene            49923..51086
FT                   /locus_tag="SGO_0048"
FT   CDS             49923..51086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0048"
FT                   /product="tagatose-6-phosphate ketose/aldose isomerase"
FT                   /EC_number="5.3.1.-"
FT                   /note="identified by match to protein family HMM PF01380"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10079"
FT                   /db_xref="GOA:A8AUB0"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035464"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUB0"
FT                   /protein_id="ABV10079.1"
FT   gene            51312..52346
FT                   /gene="galM"
FT                   /locus_tag="SGO_0049"
FT   CDS             51312..52346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galM"
FT                   /locus_tag="SGO_0049"
FT                   /product="aldose 1-epimerase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01263"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10531"
FT                   /db_xref="GOA:A8AUB1"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR015443"
FT                   /db_xref="InterPro:IPR018052"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUB1"
FT                   /protein_id="ABV10531.1"
FT                   AIAK"
FT   gene            complement(52440..53453)
FT                   /locus_tag="SGO_0050"
FT   CDS             complement(52440..53453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0050"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10376"
FT                   /db_xref="InterPro:IPR025164"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUB2"
FT                   /protein_id="ABV10376.1"
FT   gene            complement(53446..54024)
FT                   /locus_tag="SGO_0051"
FT   CDS             complement(53446..54024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0051"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10828"
FT                   /db_xref="GOA:A8AUB3"
FT                   /db_xref="InterPro:IPR012963"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUB3"
FT                   /protein_id="ABV10828.1"
FT   gene            complement(54011..54340)
FT                   /locus_tag="SGO_0052"
FT   CDS             complement(54011..54340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0052"
FT                   /product="transcriptional regulator, PadR family"
FT                   /note="identified by match to protein family HMM PF03551"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10783"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUB4"
FT                   /protein_id="ABV10783.1"
FT                   HHDKN"
FT   gene            54550..54681
FT                   /locus_tag="SGO_0053"
FT   CDS             54550..54681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0053"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09300"
FT                   /db_xref="GOA:A8AUB5"
FT                   /db_xref="InterPro:IPR021008"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUB5"
FT                   /protein_id="ABV09300.1"
FT   gene            54712..56250
FT                   /gene="dltA"
FT                   /locus_tag="SGO_0054"
FT   CDS             54712..56250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dltA"
FT                   /locus_tag="SGO_0054"
FT                   /product="D-alanine-activating enzyme"
FT                   /EC_number="6.3.2.-"
FT                   /note="identified by match to protein family HMM PF00501;
FT                   match to protein family HMM TIGR01733; match to protein
FT                   family HMM TIGR01734"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10135"
FT                   /db_xref="GOA:A8AUB6"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR010072"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUB6"
FT                   /protein_id="ABV10135.1"
FT   gene            56247..57494
FT                   /gene="dltB"
FT                   /locus_tag="SGO_0055"
FT   CDS             56247..57494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dltB"
FT                   /locus_tag="SGO_0055"
FT                   /product="integral membrane protein"
FT                   /EC_number="2.3.1.-"
FT                   /note="identified by match to protein family HMM PF03062"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09526"
FT                   /db_xref="GOA:A8AUB7"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="InterPro:IPR024024"
FT                   /db_xref="InterPro:IPR024194"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUB7"
FT                   /protein_id="ABV09526.1"
FT                   SFLIFSGFLNDLWFKK"
FT   gene            57515..57754
FT                   /gene="dltC"
FT                   /locus_tag="SGO_0056"
FT   CDS             57515..57754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dltC"
FT                   /locus_tag="SGO_0056"
FT                   /product="D-alanyl carrier protein"
FT                   /note="identified by match to protein family HMM TIGR01688"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10269"
FT                   /db_xref="GOA:A8AUB8"
FT                   /db_xref="InterPro:IPR003230"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AUB8"
FT                   /protein_id="ABV10269.1"
FT   gene            57747..59015
FT                   /locus_tag="SGO_0057"
FT   CDS             57747..59015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0057"
FT                   /product="dltD protein"
FT                   /note="identified by match to protein family HMM PF04914;
FT                   match to protein family HMM PF04915; match to protein
FT                   family HMM PF04918"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09667"
FT                   /db_xref="GOA:A8AUB9"
FT                   /db_xref="InterPro:IPR006998"
FT                   /db_xref="InterPro:IPR023896"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUB9"
FT                   /protein_id="ABV09667.1"
FT   gene            59125..59610
FT                   /locus_tag="SGO_0058"
FT   CDS             59125..59610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0058"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09486"
FT                   /db_xref="GOA:A8AUC0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUC0"
FT                   /protein_id="ABV09486.1"
FT   gene            59937..60224
FT                   /gene="pXO1"
FT                   /locus_tag="SGO_0059"
FT   CDS             59937..60224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pXO1"
FT                   /locus_tag="SGO_0059"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06013"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09951"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUC1"
FT                   /protein_id="ABV09951.1"
FT   gene            60303..63317
FT                   /locus_tag="SGO_0060"
FT   CDS             60303..63317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0060"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10407"
FT                   /db_xref="GOA:A8AUC2"
FT                   /db_xref="InterPro:IPR023838"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUC2"
FT                   /protein_id="ABV10407.1"
FT                   KPRSFQGTISQTQKV"
FT   gene            63324..63779
FT                   /locus_tag="SGO_0061"
FT   CDS             63324..63779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0061"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10865"
FT                   /db_xref="GOA:A8AUC3"
FT                   /db_xref="InterPro:IPR018920"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUC3"
FT                   /protein_id="ABV10865.1"
FT   gene            63853..64101
FT                   /locus_tag="SGO_0062"
FT   CDS             63853..64101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0062"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10110"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR024962"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUC4"
FT                   /protein_id="ABV10110.1"
FT   gene            64094..65347
FT                   /locus_tag="SGO_0063"
FT   CDS             64094..65347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0063"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09628"
FT                   /db_xref="GOA:A8AUC5"
FT                   /db_xref="InterPro:IPR018778"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUC5"
FT                   /protein_id="ABV09628.1"
FT                   ASSTEASSSTETSASSSH"
FT   gene            65367..69785
FT                   /locus_tag="SGO_0064"
FT   CDS             65367..69785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0064"
FT                   /product="FtsK/SpoIIIE family protein"
FT                   /note="identified by match to protein family HMM PF01580"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09503"
FT                   /db_xref="GOA:A8AUC6"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR023839"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUC6"
FT                   /protein_id="ABV09503.1"
FT                   YQAMKLVKGVE"
FT   gene            69785..70882
FT                   /locus_tag="SGO_0065"
FT   CDS             69785..70882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0065"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11104"
FT                   /db_xref="GOA:A8AUC7"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUC7"
FT                   /protein_id="ABV11104.1"
FT   gene            70894..71199
FT                   /locus_tag="SGO_0066"
FT   CDS             70894..71199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0066"
FT                   /product="D-3-phosphoglycerate dehydrogenase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09961"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUC8"
FT                   /protein_id="ABV09961.1"
FT   gene            71229..72653
FT                   /locus_tag="SGO_0067"
FT   CDS             71229..72653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0067"
FT                   /product="protein with prophage function domain"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10166"
FT                   /db_xref="InterPro:IPR006829"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUC9"
FT                   /protein_id="ABV10166.1"
FT                   YIWPDGFFRWIGRGFK"
FT   gene            72650..73183
FT                   /locus_tag="SGO_0068"
FT   CDS             72650..73183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0068"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09847"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUD0"
FT                   /protein_id="ABV09847.1"
FT                   EKMSLEMSDLKVNK"
FT   gene            73192..73746
FT                   /locus_tag="SGO_0069"
FT   CDS             73192..73746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0069"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09645"
FT                   /db_xref="GOA:A8AUD1"
FT                   /db_xref="InterPro:IPR021994"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUD1"
FT                   /protein_id="ABV09645.1"
FT   gene            73756..74160
FT                   /locus_tag="SGO_0070"
FT   CDS             73756..74160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0070"
FT                   /product="merozoite surface protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10765"
FT                   /db_xref="InterPro:IPR031681"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUD2"
FT                   /protein_id="ABV10765.1"
FT   gene            74387..74644
FT                   /locus_tag="SGO_0071"
FT   CDS             74387..74644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0071"
FT                   /product="putative phage protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10559"
FT                   /db_xref="GOA:A8AUD3"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUD3"
FT                   /protein_id="ABV10559.1"
FT   gene            74650..75537
FT                   /locus_tag="SGO_0072"
FT   CDS             74650..75537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0072"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11176"
FT                   /db_xref="GOA:A8AUD4"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUD4"
FT                   /protein_id="ABV11176.1"
FT                   KKYLKKHKELLKNE"
FT   gene            75530..75847
FT                   /locus_tag="SGO_0073"
FT   CDS             75530..75847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0073"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10281"
FT                   /db_xref="InterPro:IPR025233"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUD5"
FT                   /protein_id="ABV10281.1"
FT                   K"
FT   gene            76324..77568
FT                   /locus_tag="SGO_0074"
FT   CDS             76324..77568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0074"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10719"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUD6"
FT                   /protein_id="ABV10719.1"
FT                   LAYFTMPFIGKLAGR"
FT   gene            77592..78344
FT                   /locus_tag="SGO_0075"
FT   CDS             77592..78344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0075"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09342"
FT                   /db_xref="GOA:A8AUD7"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUD7"
FT                   /protein_id="ABV09342.1"
FT   gene            78636..79043
FT                   /locus_tag="SGO_0076"
FT   CDS             78636..79043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0076"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09803"
FT                   /db_xref="GOA:A8AUD8"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUD8"
FT                   /protein_id="ABV09803.1"
FT   gene            79329..79541
FT                   /locus_tag="SGO_0077"
FT   CDS             79329..79541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0077"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09740"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUD9"
FT                   /protein_id="ABV09740.1"
FT   gene            81145..81807
FT                   /locus_tag="SGO_0078"
FT   CDS             81145..81807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0078"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10623"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUE0"
FT                   /protein_id="ABV10623.1"
FT   gene            81809..82279
FT                   /locus_tag="SGO_0079"
FT   CDS             81809..82279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0079"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10947"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUE1"
FT                   /protein_id="ABV10947.1"
FT   gene            82287..83987
FT                   /locus_tag="SGO_0080"
FT   CDS             82287..83987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0080"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09612"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUE2"
FT                   /protein_id="ABV09612.1"
FT   gene            84002..84658
FT                   /locus_tag="SGO_0081"
FT   CDS             84002..84658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0081"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09175"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUE3"
FT                   /protein_id="ABV09175.1"
FT   gene            84655..84969
FT                   /locus_tag="SGO_0082"
FT   CDS             84655..84969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0082"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09786"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUE4"
FT                   /protein_id="ABV09786.1"
FT                   "
FT   gene            complement(85210..86037)
FT                   /locus_tag="SGO_0083"
FT   CDS             complement(85210..86037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0083"
FT                   /product="hydrolase, HAD superfamily, Cof family"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM PF05116; match to protein
FT                   family HMM PF08282; match to protein family HMM TIGR00099;
FT                   match to protein family HMM TIGR01484"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09893"
FT                   /db_xref="GOA:A8AUE5"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUE5"
FT                   /protein_id="ABV09893.1"
FT   gene            85972..86073
FT                   /locus_tag="SGO_0084"
FT   CDS             85972..86073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0084"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10554"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUE6"
FT                   /protein_id="ABV10554.1"
FT   gene            complement(86070..86816)
FT                   /locus_tag="SGO_0085"
FT   CDS             complement(86070..86816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0085"
FT                   /product="putative transcriptional regulator (DeoR family)"
FT                   /note="identified by match to protein family HMM PF00455;
FT                   match to protein family HMM PF08220; match to protein
FT                   family HMM PF08279"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11018"
FT                   /db_xref="GOA:A8AUE7"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUE7"
FT                   /protein_id="ABV11018.1"
FT   gene            complement(86984..87391)
FT                   /locus_tag="SGO_0086"
FT   CDS             complement(86984..87391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0086"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09517"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUE8"
FT                   /protein_id="ABV09517.1"
FT   gene            complement(87704..88870)
FT                   /locus_tag="SGO_0087"
FT   CDS             complement(87704..88870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0087"
FT                   /product="transporter, major facilitator family"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09173"
FT                   /db_xref="GOA:A8AUE9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUE9"
FT                   /protein_id="ABV09173.1"
FT   gene            complement(88917..89438)
FT                   /locus_tag="SGO_0088"
FT   CDS             complement(88917..89438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0088"
FT                   /product="transcription regulator, AcrR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09913"
FT                   /db_xref="GOA:A8AUF0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUF0"
FT                   /protein_id="ABV09913.1"
FT                   ISQYFLDLMK"
FT   gene            89598..90452
FT                   /locus_tag="SGO_0089"
FT   CDS             89598..90452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0089"
FT                   /product="cation efflux system protein"
FT                   /note="identified by match to protein family HMM PF01545;
FT                   match to protein family HMM TIGR01297"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10386"
FT                   /db_xref="GOA:A8AUF1"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUF1"
FT                   /protein_id="ABV10386.1"
FT                   RDA"
FT   gene            complement(90480..91010)
FT                   /locus_tag="SGO_0090"
FT   CDS             complement(90480..91010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0090"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10469"
FT                   /db_xref="GOA:A8AUF2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUF2"
FT                   /protein_id="ABV10469.1"
FT                   PQQMTDFLLKMLG"
FT   gene            91144..93567
FT                   /locus_tag="SGO_0091"
FT   CDS             91144..93567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0091"
FT                   /product="integral membrane protein"
FT                   /note="identified by match to protein family HMM TIGR03061;
FT                   match to protein family HMM TIGR03062"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11055"
FT                   /db_xref="GOA:A8AUF3"
FT                   /db_xref="InterPro:IPR017500"
FT                   /db_xref="InterPro:IPR017501"
FT                   /db_xref="InterPro:IPR023908"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUF3"
FT                   /protein_id="ABV11055.1"
FT   gene            93748..94485
FT                   /locus_tag="SGO_0092"
FT   CDS             93748..94485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0092"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09198"
FT                   /db_xref="InterPro:IPR018966"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUF4"
FT                   /protein_id="ABV09198.1"
FT   gene            94466..95146
FT                   /locus_tag="SGO_0093"
FT   CDS             94466..95146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0093"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09727"
FT                   /db_xref="GOA:A8AUF5"
FT                   /db_xref="InterPro:IPR032531"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUF5"
FT                   /protein_id="ABV09727.1"
FT                   ENEL"
FT   gene            95169..96431
FT                   /locus_tag="SGO_0094"
FT   CDS             95169..96431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0094"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10204"
FT                   /db_xref="InterPro:IPR025584"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUF6"
FT                   /protein_id="ABV10204.1"
FT   gene            complement(96499..97452)
FT                   /gene="mccF"
FT                   /locus_tag="SGO_0095"
FT   CDS             complement(96499..97452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mccF"
FT                   /locus_tag="SGO_0095"
FT                   /product="microcin immunity protein MccF, putative"
FT                   /note="identified by match to protein family HMM PF02016"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10396"
FT                   /db_xref="InterPro:IPR003507"
FT                   /db_xref="InterPro:IPR027461"
FT                   /db_xref="InterPro:IPR027478"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUF7"
FT                   /protein_id="ABV10396.1"
FT   gene            complement(97516..98148)
FT                   /locus_tag="SGO_0096"
FT   CDS             complement(97516..98148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0096"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01509; match to protein
FT                   family HMM TIGR01549"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09989"
FT                   /db_xref="GOA:A8AUF8"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUF8"
FT                   /protein_id="ABV09989.1"
FT   gene            98442..98951
FT                   /locus_tag="SGO_0097"
FT   CDS             98442..98951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0097"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09529"
FT                   /db_xref="GOA:A8AUF9"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUF9"
FT                   /protein_id="ABV09529.1"
FT                   VEKEPI"
FT   gene            99028..99486
FT                   /locus_tag="SGO_0098"
FT   CDS             99028..99486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0098"
FT                   /product="ribonucleotide reductase-like protein"
FT                   /note="identified by match to protein family HMM PF07972"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11157"
FT                   /db_xref="GOA:A8AUG0"
FT                   /db_xref="InterPro:IPR004465"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUG0"
FT                   /protein_id="ABV11157.1"
FT   gene            complement(99545..101638)
FT                   /gene="pulA-2"
FT                   /locus_tag="SGO_0099"
FT   CDS             complement(99545..101638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pulA-2"
FT                   /locus_tag="SGO_0099"
FT                   /product="pullulanase, type I"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00128;
FT                   match to protein family HMM PF02922; match to protein
FT                   family HMM TIGR02104"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10725"
FT                   /db_xref="GOA:A8AUG1"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011840"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUG1"
FT                   /protein_id="ABV10725.1"
FT                   VLK"
FT   gene            complement(101873..102859)
FT                   /locus_tag="SGO_0100"
FT   CDS             complement(101873..102859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0100"
FT                   /product="maltose operon transcription repressor"
FT                   /note="identified by match to protein family HMM PF00356;
FT                   match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10271"
FT                   /db_xref="GOA:A8AUG2"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUG2"
FT                   /protein_id="ABV10271.1"
FT   gene            complement(102869..103672)
FT                   /gene="malA"
FT                   /locus_tag="SGO_0101"
FT   CDS             complement(102869..103672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malA"
FT                   /locus_tag="SGO_0101"
FT                   /product="Maltodextrose utilization protein malA"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09948"
FT                   /db_xref="GOA:A8AUG3"
FT                   /db_xref="InterPro:IPR009574"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUG3"
FT                   /protein_id="ABV09948.1"
FT   gene            complement(103727..104569)
FT                   /locus_tag="SGO_0102"
FT   CDS             complement(103727..104569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0102"
FT                   /product="Maltodextrin transport system permease protein
FT                   malD"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09906"
FT                   /db_xref="GOA:A8AUG4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUG4"
FT                   /protein_id="ABV09906.1"
FT   gene            complement(104571..105866)
FT                   /locus_tag="SGO_0103"
FT   CDS             complement(104571..105866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0103"
FT                   /product="Maltodextrin transport system permease protein
FT                   malC"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM PF05154"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11154"
FT                   /db_xref="GOA:A8AUG5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUG5"
FT                   /protein_id="ABV11154.1"
FT   gene            complement(106043..107308)
FT                   /locus_tag="SGO_0104"
FT   CDS             complement(106043..107308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0104"
FT                   /product="Maltose/maltodextrin-binding protein precursor"
FT                   /note="identified by match to protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10593"
FT                   /db_xref="GOA:A8AUG6"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006060"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUG6"
FT                   /protein_id="ABV10593.1"
FT   gene            107633..109183
FT                   /gene="malQ"
FT                   /locus_tag="SGO_0105"
FT   CDS             107633..109183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malQ"
FT                   /locus_tag="SGO_0105"
FT                   /product="4-alpha-glucanotransferase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF02446;
FT                   match to protein family HMM TIGR00217"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09690"
FT                   /db_xref="GOA:A8AUG7"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUG7"
FT                   /protein_id="ABV09690.1"
FT   gene            109176..111437
FT                   /gene="glgP-2"
FT                   /locus_tag="SGO_0106"
FT   CDS             109176..111437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgP-2"
FT                   /locus_tag="SGO_0106"
FT                   /product="maltodextrin phosphorylase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00343;
FT                   match to protein family HMM TIGR02093"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09317"
FT                   /db_xref="GOA:A8AUG8"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUG8"
FT                   /protein_id="ABV09317.1"
FT                   "
FT   gene            111776..114952
FT                   /locus_tag="SGO_0107"
FT   CDS             111776..114952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0107"
FT                   /product="LPXTG cell wall surface protein, collagen binding
FT                   domain"
FT                   /note="identified by match to protein family HMM PF00746;
FT                   match to protein family HMM PF05737; match to protein
FT                   family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10599"
FT                   /db_xref="GOA:A8AUG9"
FT                   /db_xref="InterPro:IPR008456"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR011252"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR022464"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUG9"
FT                   /protein_id="ABV10599.1"
FT                   VFLYRTKKVN"
FT   gene            115064..116062
FT                   /gene="ruvB"
FT                   /locus_tag="SGO_0108"
FT   CDS             115064..116062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvB"
FT                   /locus_tag="SGO_0108"
FT                   /product="Holliday junction DNA helicase RuvB"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF05491; match to protein
FT                   family HMM PF05496; match to protein family HMM PF07728;
FT                   match to protein family HMM TIGR00635"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10282"
FT                   /db_xref="GOA:A8AUH0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AUH0"
FT                   /protein_id="ABV10282.1"
FT   gene            116067..116645
FT                   /locus_tag="SGO_0109"
FT   CDS             116067..116645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0109"
FT                   /product="Bacterial protein of unknown function (DUF925)
FT                   superfamily"
FT                   /note="identified by match to protein family HMM PF06042"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11005"
FT                   /db_xref="InterPro:IPR009267"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUH1"
FT                   /protein_id="ABV11005.1"
FT   gene            116893..117315
FT                   /locus_tag="SGO_0110"
FT   CDS             116893..117315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0110"
FT                   /product="phosphotyrosine protein phosphatase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01451"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10546"
FT                   /db_xref="GOA:A8AUH2"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUH2"
FT                   /protein_id="ABV10546.1"
FT   gene            117318..117731
FT                   /locus_tag="SGO_0111"
FT   CDS             117318..117731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0111"
FT                   /product="MORN motif family protein"
FT                   /note="identified by match to protein family HMM PF02493"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10991"
FT                   /db_xref="GOA:A8AUH3"
FT                   /db_xref="InterPro:IPR003409"
FT                   /db_xref="InterPro:IPR014590"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUH3"
FT                   /protein_id="ABV10991.1"
FT   gene            117721..119535
FT                   /locus_tag="SGO_0112"
FT   CDS             117721..119535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0112"
FT                   /product="putative acyltransferase"
FT                   /note="identified by match to protein family HMM PF01757"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10561"
FT                   /db_xref="GOA:A8AUH4"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUH4"
FT                   /protein_id="ABV10561.1"
FT   gene            119851..122502
FT                   /gene="acdH"
FT                   /locus_tag="SGO_0113"
FT   CDS             119851..122502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acdH"
FT                   /locus_tag="SGO_0113"
FT                   /product="alcohol-acetaldehyde dehydrogenase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00171;
FT                   match to protein family HMM PF00465"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09809"
FT                   /db_xref="GOA:A8AUH5"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR012079"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR034789"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUH5"
FT                   /protein_id="ABV09809.1"
FT                   YYGYKERPGRRK"
FT   gene            122898..123440
FT                   /locus_tag="SGO_0114"
FT   CDS             122898..123440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0114"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09311"
FT                   /db_xref="GOA:A8AUH6"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUH6"
FT                   /protein_id="ABV09311.1"
FT                   AFTIFFILVLWYYLHPF"
FT   gene            complement(123654..123815)
FT                   /gene="sthB"
FT                   /locus_tag="SGO_0115"
FT   CDS             complement(123654..123815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sthB"
FT                   /locus_tag="SGO_0115"
FT                   /product="Bacteriocin"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10183"
FT                   /db_xref="GOA:A8AUH7"
FT                   /db_xref="InterPro:IPR023991"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUH7"
FT                   /protein_id="ABV10183.1"
FT                   YALARIFG"
FT   gene            complement(123957..124130)
FT                   /gene="sthA"
FT                   /locus_tag="SGO_0116"
FT   CDS             complement(123957..124130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sthA"
FT                   /locus_tag="SGO_0116"
FT                   /product="Bacteriocin"
FT                   /note="identified by match to protein family HMM TIGR01847"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09453"
FT                   /db_xref="GOA:A8AUH8"
FT                   /db_xref="InterPro:IPR010133"
FT                   /db_xref="InterPro:IPR023991"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUH8"
FT                   /protein_id="ABV09453.1"
FT                   GIAVGLNRVNRK"
FT   gene            124235..124402
FT                   /locus_tag="SGO_0117"
FT   CDS             124235..124402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0117"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10667"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUH9"
FT                   /protein_id="ABV10667.1"
FT                   IISNLLDFEK"
FT   gene            124700..125401
FT                   /locus_tag="SGO_0118"
FT   CDS             124700..125401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0118"
FT                   /product="N-acetylmannosamine-6-phosphate epimerase,
FT                   putative"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF04131"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11084"
FT                   /db_xref="GOA:A8AUI0"
FT                   /db_xref="InterPro:IPR007260"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AUI0"
FT                   /protein_id="ABV11084.1"
FT                   ITERFVAAVKK"
FT   gene            125440..125892
FT                   /locus_tag="SGO_0119"
FT   CDS             125440..125892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0119"
FT                   /product="conserved hypothetical protein subfamily"
FT                   /note="identified by match to protein family HMM PF04074;
FT                   match to protein family HMM TIGR00022"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09255"
FT                   /db_xref="InterPro:IPR004375"
FT                   /db_xref="InterPro:IPR037012"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUI1"
FT                   /protein_id="ABV09255.1"
FT   gene            125910..127262
FT                   /locus_tag="SGO_0120"
FT   CDS             125910..127262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0120"
FT                   /product="Bacterial extracellular solute-binding protein
FT                   domain protein"
FT                   /note="identified by match to protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09856"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUI2"
FT                   /protein_id="ABV09856.1"
FT   gene            127327..128211
FT                   /locus_tag="SGO_0121"
FT   CDS             127327..128211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0121"
FT                   /product="ABC transporter, permease protein SP1689"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10218"
FT                   /db_xref="GOA:A8AUI3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUI3"
FT                   /protein_id="ABV10218.1"
FT                   FGIISKWEKEGRK"
FT   gene            128211..129044
FT                   /locus_tag="SGO_0122"
FT   CDS             128211..129044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0122"
FT                   /product="ABC transporter, permease protein SP1688"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10809"
FT                   /db_xref="GOA:A8AUI4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUI4"
FT                   /protein_id="ABV10809.1"
FT   gene            129086..130189
FT                   /locus_tag="SGO_0123"
FT   CDS             129086..130189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0123"
FT                   /product="oxidoreductase, Gfo/Idh/MocA family SP1325"
FT                   /EC_number="1.-.-.-"
FT                   /note="identified by match to protein family HMM PF01118;
FT                   match to protein family HMM PF01408; match to protein
FT                   family HMM PF02894; match to protein family HMM PF03447"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11080"
FT                   /db_xref="GOA:A8AUI5"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUI5"
FT                   /protein_id="ABV11080.1"
FT   gene            130252..131169
FT                   /locus_tag="SGO_0124"
FT   CDS             130252..131169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0124"
FT                   /product="N-acetylneuraminate lyase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00701"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09608"
FT                   /db_xref="GOA:A8AUI6"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUI6"
FT                   /protein_id="ABV09608.1"
FT   gene            131203..132087
FT                   /gene="xylR"
FT                   /locus_tag="SGO_0125"
FT   CDS             131203..132087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xylR"
FT                   /locus_tag="SGO_0125"
FT                   /product="glucokinase"
FT                   /note="identified by match to protein family HMM PF00480"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09970"
FT                   /db_xref="GOA:A8AUI7"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUI7"
FT                   /protein_id="ABV09970.1"
FT                   MFGAYYHFKNRQV"
FT   gene            132133..132462
FT                   /locus_tag="SGO_0126"
FT   CDS             132133..132462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0126"
FT                   /product="BlpT protein, fusion"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10305"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUI8"
FT                   /protein_id="ABV10305.1"
FT                   PILPL"
FT   gene            complement(132523..133377)
FT                   /locus_tag="SGO_0127"
FT   CDS             complement(132523..133377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0127"
FT                   /product="phosphosugar-binding transcriptional regulator,
FT                   RpiR family"
FT                   /note="identified by match to protein family HMM PF01380;
FT                   match to protein family HMM PF01418"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10807"
FT                   /db_xref="GOA:A8AUI9"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUI9"
FT                   /protein_id="ABV10807.1"
FT                   HKR"
FT   gene            133619..133942
FT                   /locus_tag="SGO_0128"
FT   CDS             133619..133942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0128"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09313"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUJ0"
FT                   /protein_id="ABV09313.1"
FT                   YGH"
FT   gene            133932..135887
FT                   /gene="atpI"
FT                   /locus_tag="SGO_0129"
FT   CDS             133932..135887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpI"
FT                   /locus_tag="SGO_0129"
FT                   /product="v-type sodium ATP synthase, chain I"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01496"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09869"
FT                   /db_xref="GOA:A8AUJ1"
FT                   /db_xref="InterPro:IPR002490"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUJ1"
FT                   /protein_id="ABV09869.1"
FT                   FTPLKPSEKYVQQSKK"
FT   gene            136020..136499
FT                   /gene="atpK"
FT                   /locus_tag="SGO_0130"
FT   CDS             136020..136499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpK"
FT                   /locus_tag="SGO_0130"
FT                   /product="v-type sodium ATP synthase, chain K"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00137"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11048"
FT                   /db_xref="GOA:A8AUJ2"
FT                   /db_xref="InterPro:IPR000245"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUJ2"
FT                   /protein_id="ABV11048.1"
FT   gene            136510..137100
FT                   /locus_tag="SGO_0131"
FT   CDS             136510..137100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0131"
FT                   /product="v-type sodium ATP synthase, chain E"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09547"
FT                   /db_xref="GOA:A8AUJ3"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUJ3"
FT                   /protein_id="ABV09547.1"
FT   gene            137111..138124
FT                   /locus_tag="SGO_0132"
FT   CDS             137111..138124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0132"
FT                   /product="ATP synthase (C/AC39) subunit"
FT                   /note="identified by match to protein family HMM PF01992"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10205"
FT                   /db_xref="InterPro:IPR002843"
FT                   /db_xref="InterPro:IPR035067"
FT                   /db_xref="InterPro:IPR036079"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUJ4"
FT                   /protein_id="ABV10205.1"
FT   gene            138111..138431
FT                   /locus_tag="SGO_0133"
FT   CDS             138111..138431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0133"
FT                   /product="ATP synthase (F/14-kDa) subunit"
FT                   /note="identified by match to protein family HMM PF01990"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10784"
FT                   /db_xref="GOA:A8AUJ5"
FT                   /db_xref="InterPro:IPR008218"
FT                   /db_xref="InterPro:IPR036906"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUJ5"
FT                   /protein_id="ABV10784.1"
FT                   IL"
FT   gene            138439..139134
FT                   /locus_tag="SGO_0134"
FT   CDS             138439..139134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0134"
FT                   /product="acetyltransferase, GNAT family"
FT                   /EC_number="2.3.1.-"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09296"
FT                   /db_xref="GOA:A8AUJ6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUJ6"
FT                   /protein_id="ABV09296.1"
FT                   QQIKALSDF"
FT   gene            139299..141089
FT                   /locus_tag="SGO_0135"
FT   CDS             139299..141089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0135"
FT                   /product="v-type sodium ATP synthase, subunit A"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00006;
FT                   match to protein family HMM PF00306; match to protein
FT                   family HMM PF02874"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09814"
FT                   /db_xref="GOA:A8AUJ7"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR022878"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031686"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AUJ7"
FT                   /protein_id="ABV09814.1"
FT   gene            141076..142470
FT                   /locus_tag="SGO_0136"
FT   CDS             141076..142470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0136"
FT                   /product="v-type sodium ATP synthase, chain B"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00006;
FT                   match to protein family HMM PF00306; match to protein
FT                   family HMM PF02874"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09355"
FT                   /db_xref="GOA:A8AUJ8"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022879"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AUJ8"
FT                   /protein_id="ABV09355.1"
FT                   TKEEER"
FT   gene            142467..143090
FT                   /locus_tag="SGO_0137"
FT   CDS             142467..143090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0137"
FT                   /product="V-type ATPase, D subunit"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01813;
FT                   match to protein family HMM TIGR00309"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10739"
FT                   /db_xref="GOA:A8AUJ9"
FT                   /db_xref="InterPro:IPR002699"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AUJ9"
FT                   /protein_id="ABV10739.1"
FT   gene            143553..144689
FT                   /locus_tag="SGO_0138"
FT   CDS             143553..144689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0138"
FT                   /product="LysM domain protein"
FT                   /note="identified by match to protein family HMM PF01476"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10283"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUK0"
FT                   /protein_id="ABV10283.1"
FT   gene            144806..146290
FT                   /gene="thrC"
FT                   /locus_tag="SGO_0139"
FT   CDS             144806..146290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrC"
FT                   /locus_tag="SGO_0139"
FT                   /product="threonine synthase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00291;
FT                   match to protein family HMM TIGR00260"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10705"
FT                   /db_xref="GOA:A8AUK1"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR029144"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR037158"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUK1"
FT                   /protein_id="ABV10705.1"
FT   gene            146397..147674
FT                   /locus_tag="SGO_0140"
FT   CDS             146397..147674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0140"
FT                   /product="Multi antimicrobial extrusion family transporter,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF01554;
FT                   match to protein family HMM TIGR00797"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10249"
FT                   /db_xref="GOA:A8AUK2"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUK2"
FT                   /protein_id="ABV10249.1"
FT   gene            147671..148285
FT                   /locus_tag="SGO_0141"
FT   CDS             147671..148285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0141"
FT                   /product="hydrolase, haloacid dehalogenase-like family"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01549"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10097"
FT                   /db_xref="GOA:A8AUK3"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUK3"
FT                   /protein_id="ABV10097.1"
FT   gene            complement(148333..148818)
FT                   /locus_tag="SGO_0142"
FT   CDS             complement(148333..148818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0142"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09633"
FT                   /db_xref="GOA:A8AUK4"
FT                   /db_xref="InterPro:IPR025588"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUK4"
FT                   /protein_id="ABV09633.1"
FT   gene            149058..152636
FT                   /locus_tag="SGO_0144"
FT   CDS             149058..152636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0144"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10551"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUK5"
FT                   /protein_id="ABV10551.1"
FT   gene            152698..155340
FT                   /gene="polI"
FT                   /locus_tag="SGO_0145"
FT   CDS             152698..155340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polI"
FT                   /locus_tag="SGO_0145"
FT                   /product="DNA polymerase I"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00476;
FT                   match to protein family HMM PF01367; match to protein
FT                   family HMM PF02739; match to protein family HMM TIGR00593"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09290"
FT                   /db_xref="GOA:A8AUK6"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUK6"
FT                   /protein_id="ABV09290.1"
FT                   AGQTWYEAK"
FT   gene            155696..156133
FT                   /locus_tag="SGO_0146"
FT   CDS             155696..156133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0146"
FT                   /product="CoA-binding domain protein"
FT                   /note="identified by match to protein family HMM PF02629"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10693"
FT                   /db_xref="GOA:A8AUK7"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUK7"
FT                   /protein_id="ABV10693.1"
FT   gene            156135..156632
FT                   /locus_tag="SGO_0147"
FT   CDS             156135..156632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0147"
FT                   /product="putative kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09785"
FT                   /db_xref="GOA:A8AUK8"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUK8"
FT                   /protein_id="ABV09785.1"
FT                   RF"
FT   gene            156795..157409
FT                   /locus_tag="SGO_0148"
FT   CDS             156795..157409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0148"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09294"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUK9"
FT                   /protein_id="ABV09294.1"
FT   gene            157657..157977
FT                   /locus_tag="SGO_0149"
FT   CDS             157657..157977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0149"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10981"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUL0"
FT                   /protein_id="ABV10981.1"
FT                   DG"
FT   gene            158080..159546
FT                   /gene="fucA1"
FT                   /locus_tag="SGO_0150"
FT   CDS             158080..159546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fucA1"
FT                   /locus_tag="SGO_0150"
FT                   /product="alpha-L-fucosidase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01120"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10439"
FT                   /db_xref="GOA:A8AUL1"
FT                   /db_xref="InterPro:IPR000933"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR031919"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUL1"
FT                   /protein_id="ABV10439.1"
FT   gene            complement(159650..160477)
FT                   /locus_tag="SGO_0151"
FT   CDS             complement(159650..160477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0151"
FT                   /product="Protein of unknown function (DUF975) superfamily"
FT                   /note="identified by match to protein family HMM PF06161"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10763"
FT                   /db_xref="GOA:A8AUL2"
FT                   /db_xref="InterPro:IPR010380"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUL2"
FT                   /protein_id="ABV10763.1"
FT   gene            160617..161759
FT                   /gene="tgt"
FT                   /locus_tag="SGO_0152"
FT   CDS             160617..161759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tgt"
FT                   /locus_tag="SGO_0152"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01702;
FT                   match to protein family HMM TIGR00430; match to protein
FT                   family HMM TIGR00449"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10168"
FT                   /db_xref="GOA:A8AUL3"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AUL3"
FT                   /protein_id="ABV10168.1"
FT   gene            161850..162383
FT                   /locus_tag="SGO_0153"
FT   CDS             161850..162383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0153"
FT                   /product="cytidine/deoxycytidylate deaminase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00383"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09865"
FT                   /db_xref="GOA:A8AUL4"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUL4"
FT                   /protein_id="ABV09865.1"
FT                   AQIMQDFFRNRRQK"
FT   gene            163004..164353
FT                   /gene="pgi"
FT                   /locus_tag="SGO_0154"
FT   CDS             163004..164353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgi"
FT                   /locus_tag="SGO_0154"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00342"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09302"
FT                   /db_xref="GOA:A8AUL5"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AUL5"
FT                   /protein_id="ABV09302.1"
FT   gene            164536..165444
FT                   /locus_tag="SGO_0155"
FT   CDS             164536..165444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0155"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10460"
FT                   /db_xref="GOA:A8AUL6"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUL6"
FT                   /protein_id="ABV10460.1"
FT   gene            165466..166272
FT                   /locus_tag="SGO_0156"
FT   CDS             165466..166272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0156"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11047"
FT                   /db_xref="GOA:A8AUL7"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUL7"
FT                   /protein_id="ABV11047.1"
FT   gene            166681..167631
FT                   /locus_tag="SGO_0157"
FT   CDS             166681..167631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0157"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09551"
FT                   /db_xref="GOA:A8AUL8"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUL8"
FT                   /protein_id="ABV09551.1"
FT   gene            167743..168441
FT                   /locus_tag="SGO_0158"
FT   CDS             167743..168441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0158"
FT                   /product="2,3,4,5-tetrahydropyridine-2-carboxylate
FT                   N-succinyltransferase, putative"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00132;
FT                   match to protein family HMM PF08503"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10130"
FT                   /db_xref="GOA:A8AUL9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR013710"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR019873"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AUL9"
FT                   /protein_id="ABV10130.1"
FT                   TALEDALRTL"
FT   gene            168531..169664
FT                   /locus_tag="SGO_0159"
FT   CDS             168531..169664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0159"
FT                   /product="hippurate hydrolase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01546;
FT                   match to protein family HMM PF07687; match to protein
FT                   family HMM TIGR01891"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10792"
FT                   /db_xref="GOA:A8AUM0"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR023905"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AUM0"
FT                   /protein_id="ABV10792.1"
FT   gene            169685..170218
FT                   /locus_tag="SGO_0160"
FT   CDS             169685..170218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0160"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase family
FT                   protein"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01812;
FT                   match to protein family HMM TIGR02727"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09542"
FT                   /db_xref="GOA:A8AUM1"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUM1"
FT                   /protein_id="ABV09542.1"
FT                   VSVKELIIYETNLR"
FT   gene            170199..170882
FT                   /locus_tag="SGO_0161"
FT   CDS             170199..170882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0161"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01694"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09692"
FT                   /db_xref="GOA:A8AUM2"
FT                   /db_xref="InterPro:IPR002610"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUM2"
FT                   /protein_id="ABV09692.1"
FT                   QRPIF"
FT   gene            171195..173153
FT                   /gene="abpB"
FT                   /locus_tag="SGO_0162"
FT   CDS             171195..173153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="abpB"
FT                   /locus_tag="SGO_0162"
FT                   /product="amylase-binding protein B"
FT                   /EC_number="3.4.-.-"
FT                   /note="identified by match to protein family HMM PF03577"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10415"
FT                   /db_xref="GOA:A8AUM3"
FT                   /db_xref="InterPro:IPR005322"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUM3"
FT                   /protein_id="ABV10415.1"
FT                   YEGGKDFKNIGTFSNGN"
FT   gene            complement(173267..174175)
FT                   /gene="galU"
FT                   /locus_tag="SGO_0163"
FT   CDS             complement(173267..174175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galU"
FT                   /locus_tag="SGO_0163"
FT                   /product="UTP-glucose-1-phosphate uridylyltransferase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00483;
FT                   match to protein family HMM TIGR01099"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10363"
FT                   /db_xref="GOA:A8AUM4"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUM4"
FT                   /protein_id="ABV10363.1"
FT   gene            complement(174205..175221)
FT                   /locus_tag="SGO_0164"
FT   CDS             complement(174205..175221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0164"
FT                   /product="Glycerol-3-phosphate dehydrogenase [NAD(P)+]
FT                   (NAD(P)H-dependent glycerol-3-phosphate dehydrogenase)"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01210;
FT                   match to protein family HMM PF03721; match to protein
FT                   family HMM PF03807; match to protein family HMM PF07479"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10937"
FT                   /db_xref="GOA:A8AUM5"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AUM5"
FT                   /protein_id="ABV10937.1"
FT   gene            175414..177123
FT                   /locus_tag="SGO_0165"
FT   CDS             175414..177123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0165"
FT                   /product="ABC transporter, permease/ATP-binding protein
FT                   SP2075"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09284"
FT                   /db_xref="GOA:A8AUM6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUM6"
FT                   /protein_id="ABV09284.1"
FT   gene            177125..178894
FT                   /locus_tag="SGO_0166"
FT   CDS             177125..178894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0166"
FT                   /product="ABC transporter, permease/ATP-binding protein
FT                   SP2073"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10032"
FT                   /db_xref="GOA:A8AUM7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUM7"
FT                   /protein_id="ABV10032.1"
FT                   FYSELYHNQFVFE"
FT   gene            179073..179762
FT                   /locus_tag="SGO_0167"
FT   CDS             179073..179762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0167"
FT                   /product="glutamine amidotransferase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00117;
FT                   match to protein family HMM PF07722"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10596"
FT                   /db_xref="GOA:A8AUM8"
FT                   /db_xref="InterPro:IPR011697"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUM8"
FT                   /protein_id="ABV10596.1"
FT                   HYLLQEL"
FT   gene            180021..180470
FT                   /locus_tag="SGO_0168"
FT   CDS             180021..180470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0168"
FT                   /product="hydrolase, NUDIX family"
FT                   /note="identified by match to protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10250"
FT                   /db_xref="GOA:A8AUM9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUM9"
FT                   /protein_id="ABV10250.1"
FT   gene            180555..180998
FT                   /gene="dut"
FT                   /locus_tag="SGO_0169"
FT   CDS             180555..180998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dut"
FT                   /locus_tag="SGO_0169"
FT                   /product="dUTP diphosphatase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00692"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10726"
FT                   /db_xref="GOA:A8AUN0"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUN0"
FT                   /protein_id="ABV10726.1"
FT   gene            181008..181475
FT                   /locus_tag="SGO_0170"
FT   CDS             181008..181475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0170"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09674"
FT                   /db_xref="GOA:A8AUN1"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUN1"
FT                   /protein_id="ABV09674.1"
FT   gene            181433..182833
FT                   /gene="radA"
FT                   /locus_tag="SGO_0171"
FT   CDS             181433..182833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="SGO_0171"
FT                   /product="DNA repair protein RadA"
FT                   /note="identified by match to protein family HMM TIGR00416"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09733"
FT                   /db_xref="GOA:A8AUN2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUN2"
FT                   /protein_id="ABV09733.1"
FT                   EVLKKVFS"
FT   gene            182946..183656
FT                   /locus_tag="SGO_0172"
FT   CDS             182946..183656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0172"
FT                   /product="conserved hypothetical protein TIGR00266"
FT                   /note="identified by match to protein family HMM PF01987;
FT                   match to protein family HMM TIGR00266"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11088"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="InterPro:IPR036983"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUN3"
FT                   /protein_id="ABV11088.1"
FT                   TFAKILGGYIPTKE"
FT   gene            183792..184286
FT                   /locus_tag="SGO_0173"
FT   CDS             183792..184286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0173"
FT                   /product="Carbonic anhydrase"
FT                   /note="identified by match to protein family HMM PF00484"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09425"
FT                   /db_xref="GOA:A8AUN4"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUN4"
FT                   /protein_id="ABV09425.1"
FT                   L"
FT   gene            184436..185893
FT                   /gene="gltX"
FT                   /locus_tag="SGO_0174"
FT   CDS             184436..185893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /locus_tag="SGO_0174"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00749;
FT                   match to protein family HMM TIGR00464"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10390"
FT                   /db_xref="GOA:A8AUN5"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AUN5"
FT                   /protein_id="ABV10390.1"
FT   gene            186069..187268
FT                   /gene="argG"
FT                   /locus_tag="SGO_0175"
FT   CDS             186069..187268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argG"
FT                   /locus_tag="SGO_0175"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00764;
FT                   match to protein family HMM TIGR00032"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10858"
FT                   /db_xref="GOA:A8AUN6"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AUN6"
FT                   /protein_id="ABV10858.1"
FT                   "
FT   gene            187283..188668
FT                   /gene="argH"
FT                   /locus_tag="SGO_0176"
FT   CDS             187283..188668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argH"
FT                   /locus_tag="SGO_0176"
FT                   /product="argininosuccinate lyase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00206;
FT                   match to protein family HMM TIGR00838"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09245"
FT                   /db_xref="GOA:A8AUN7"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AUN7"
FT                   /protein_id="ABV09245.1"
FT                   NNK"
FT   gene            188724..188819
FT                   /locus_tag="SGO_0177"
FT   CDS             188724..188819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0177"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09654"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUN8"
FT                   /protein_id="ABV09654.1"
FT                   /translation="MKVEIALKVAGIGFLEKYGIIDIILVDGVEF"
FT   gene            188816..189175
FT                   /gene="rnpA"
FT                   /locus_tag="SGO_0178"
FT   CDS             188816..189175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnpA"
FT                   /locus_tag="SGO_0178"
FT                   /product="ribonuclease P protein component"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00825;
FT                   match to protein family HMM TIGR00188"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11078"
FT                   /db_xref="GOA:A8AUN9"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AUN9"
FT                   /protein_id="ABV11078.1"
FT                   LAKIYQEGIPSEKEE"
FT   gene            189159..189974
FT                   /locus_tag="SGO_0179"
FT   CDS             189159..189974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0179"
FT                   /product="Membrane protein oxaA 1 precursor"
FT                   /note="identified by match to protein family HMM PF02096"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09309"
FT                   /db_xref="GOA:A8AUP0"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR023060"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUP0"
FT                   /protein_id="ABV09309.1"
FT   gene            189990..190952
FT                   /gene="jag"
FT                   /locus_tag="SGO_0180"
FT   CDS             189990..190952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="jag"
FT                   /locus_tag="SGO_0180"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01424"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10442"
FT                   /db_xref="GOA:A8AUP1"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR032782"
FT                   /db_xref="InterPro:IPR034079"
FT                   /db_xref="InterPro:IPR036867"
FT                   /db_xref="InterPro:IPR038008"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUP1"
FT                   /protein_id="ABV10442.1"
FT   gene            191078..192076
FT                   /locus_tag="SGO_0181"
FT   CDS             191078..192076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0181"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11032"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUP2"
FT                   /protein_id="ABV11032.1"
FT   gene            192091..192723
FT                   /gene="sapR"
FT                   /locus_tag="SGO_0182"
FT   CDS             192091..192723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sapR"
FT                   /locus_tag="SGO_0182"
FT                   /product="sakacin A production response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10764"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUP3"
FT                   /protein_id="ABV10764.1"
FT   gene            192863..192997
FT                   /gene="rpmH"
FT                   /locus_tag="SGO_0183"
FT   CDS             192863..192997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmH"
FT                   /locus_tag="SGO_0183"
FT                   /product="ribosomal protein L34"
FT                   /note="identified by match to protein family HMM PF00468;
FT                   match to protein family HMM TIGR01030"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09280"
FT                   /db_xref="GOA:A8AUP4"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AUP4"
FT                   /protein_id="ABV09280.1"
FT   gene            complement(193139..194548)
FT                   /locus_tag="SGO_0184"
FT   CDS             complement(193139..194548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0184"
FT                   /product="urease cluster protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11017"
FT                   /db_xref="GOA:A8AUP5"
FT                   /db_xref="InterPro:IPR025231"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUP5"
FT                   /protein_id="ABV11017.1"
FT                   ILCYLYPFLLK"
FT   gene            complement(194550..194768)
FT                   /locus_tag="SGO_0185"
FT   CDS             complement(194550..194768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0185"
FT                   /product="transcription regulator-like protein yozG"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09576"
FT                   /db_xref="GOA:A8AUP6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUP6"
FT                   /protein_id="ABV09576.1"
FT   gene            complement(194777..195253)
FT                   /locus_tag="SGO_0186"
FT   CDS             complement(194777..195253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0186"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09426"
FT                   /db_xref="GOA:A8AUP7"
FT                   /db_xref="InterPro:IPR021354"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUP7"
FT                   /protein_id="ABV09426.1"
FT   gene            195416..195508
FT                   /locus_tag="SGO_0187"
FT   CDS             195416..195508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0187"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10019"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUP8"
FT                   /protein_id="ABV10019.1"
FT                   /translation="MSYFIYFEETSDFLGHFWYNKGQEIQGSKP"
FT   gene            195505..196275
FT                   /locus_tag="SGO_0188"
FT   CDS             195505..196275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0188"
FT                   /product="hydrolase, TatD family"
FT                   /note="identified by match to protein family HMM PF01026;
FT                   match to protein family HMM TIGR00010"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10314"
FT                   /db_xref="GOA:A8AUP9"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUP9"
FT                   /protein_id="ABV10314.1"
FT   gene            196247..196837
FT                   /locus_tag="SGO_0189"
FT   CDS             196247..196837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0189"
FT                   /product="primase-related protein"
FT                   /note="identified by match to protein family HMM PF01751;
FT                   match to protein family HMM TIGR00334"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10898"
FT                   /db_xref="GOA:A8AUQ0"
FT                   /db_xref="InterPro:IPR004466"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR025156"
FT                   /db_xref="InterPro:IPR034141"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUQ0"
FT                   /protein_id="ABV10898.1"
FT   gene            196849..197703
FT                   /locus_tag="SGO_0190"
FT   CDS             196849..197703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0190"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10755"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUQ1"
FT                   /protein_id="ABV10755.1"
FT                   DNE"
FT   gene            197740..199155
FT                   /locus_tag="SGO_0191"
FT   CDS             197740..199155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0191"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11177"
FT                   /db_xref="InterPro:IPR009839"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUQ2"
FT                   /protein_id="ABV11177.1"
FT                   EKISAELNDAPKQ"
FT   gene            199167..199502
FT                   /locus_tag="SGO_0192"
FT   CDS             199167..199502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0192"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09875"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUQ3"
FT                   /protein_id="ABV09875.1"
FT                   LKRKENR"
FT   gene            199499..200371
FT                   /gene="ksgA"
FT                   /locus_tag="SGO_0193"
FT   CDS             199499..200371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="SGO_0193"
FT                   /product="dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF00398;
FT                   match to protein family HMM TIGR00755"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09208"
FT                   /db_xref="GOA:A8AUQ4"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AUQ4"
FT                   /protein_id="ABV09208.1"
FT                   SDALKSEGL"
FT   gene            200429..200836
FT                   /locus_tag="SGO_0194"
FT   CDS             200429..200836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0194"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10330"
FT                   /db_xref="GOA:A8AUQ5"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUQ5"
FT                   /protein_id="ABV10330.1"
FT   gene            complement(200849..200934)
FT                   /locus_tag="SGO_0195"
FT   tRNA            complement(200849..200934)
FT                   /locus_tag="SGO_0195"
FT                   /product="tRNA-Leu"
FT   gene            complement(201110..202027)
FT                   /locus_tag="SGO_0196"
FT   CDS             complement(201110..202027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0196"
FT                   /product="protease, putative"
FT                   /note="identified by match to protein family HMM PF02517"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10886"
FT                   /db_xref="GOA:A8AUQ6"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUQ6"
FT                   /protein_id="ABV10886.1"
FT   gene            202373..203251
FT                   /locus_tag="SGO_0197"
FT   CDS             202373..203251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0197"
FT                   /product="predicted ribosome small subunit-dependent GTPase
FT                   A"
FT                   /note="identified by match to protein family HMM PF03193;
FT                   match to protein family HMM TIGR00157"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09449"
FT                   /db_xref="GOA:A8AUQ7"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="InterPro:IPR031944"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUQ7"
FT                   /protein_id="ABV09449.1"
FT                   TYKKTAKKIPK"
FT   gene            203268..203927
FT                   /gene="rpe"
FT                   /locus_tag="SGO_0198"
FT   CDS             203268..203927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpe"
FT                   /locus_tag="SGO_0198"
FT                   /product="ribulose-phosphate 3-epimerase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00215;
FT                   match to protein family HMM PF00834; match to protein
FT                   family HMM TIGR01163"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09923"
FT                   /db_xref="GOA:A8AUQ8"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUQ8"
FT                   /protein_id="ABV09923.1"
FT   gene            203866..204552
FT                   /locus_tag="SGO_0199"
FT   CDS             203866..204552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0199"
FT                   /product="thiamine pyrophosphokinase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF04263;
FT                   match to protein family HMM PF04265; match to protein
FT                   family HMM TIGR01378"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10624"
FT                   /db_xref="GOA:A8AUQ9"
FT                   /db_xref="InterPro:IPR006282"
FT                   /db_xref="InterPro:IPR007371"
FT                   /db_xref="InterPro:IPR007373"
FT                   /db_xref="InterPro:IPR036759"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUQ9"
FT                   /protein_id="ABV10624.1"
FT                   YSKDRN"
FT   gene            204554..205810
FT                   /locus_tag="SGO_0200"
FT   CDS             204554..205810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0200"
FT                   /product="competence-induced protein Ccs50"
FT                   /note="identified by match to protein family HMM PF02646"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09249"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUR0"
FT                   /protein_id="ABV09249.1"
FT   gene            205800..206741
FT                   /locus_tag="SGO_0201"
FT   CDS             205800..206741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0201"
FT                   /product="cmp-binding-factor 1"
FT                   /note="identified by match to protein family HMM PF01336;
FT                   match to protein family HMM PF01966"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09725"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUR1"
FT                   /protein_id="ABV09725.1"
FT   gene            206837..207652
FT                   /locus_tag="SGO_0202"
FT   CDS             206837..207652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0202"
FT                   /product="pur operon repressor"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM PF09182; match to protein
FT                   family HMM TIGR01743"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10422"
FT                   /db_xref="GOA:A8AUR2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR010078"
FT                   /db_xref="InterPro:IPR015265"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUR2"
FT                   /protein_id="ABV10422.1"
FT   gene            207667..208206
FT                   /locus_tag="SGO_0203"
FT   CDS             207667..208206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0203"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09888"
FT                   /db_xref="GOA:A8AUR3"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUR3"
FT                   /protein_id="ABV09888.1"
FT                   TQVQNEEAPSANTTTQ"
FT   gene            208451..208864
FT                   /gene="rpsL"
FT                   /locus_tag="SGO_0204"
FT   CDS             208451..208864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="SGO_0204"
FT                   /product="ribosomal protein S12"
FT                   /note="identified by match to protein family HMM PF00164;
FT                   match to protein family HMM TIGR00981"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10215"
FT                   /db_xref="GOA:Q9F0R4"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9F0R4"
FT                   /protein_id="ABV10215.1"
FT   gene            208884..209354
FT                   /gene="rpsG"
FT                   /locus_tag="SGO_0205"
FT   CDS             208884..209354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="SGO_0205"
FT                   /product="ribosomal protein S7"
FT                   /note="identified by match to protein family HMM PF00177;
FT                   match to protein family HMM TIGR01029"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11099"
FT                   /db_xref="GOA:A8AUR5"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AUR5"
FT                   /protein_id="ABV11099.1"
FT   gene            209769..211850
FT                   /gene="fusA"
FT                   /locus_tag="SGO_0206"
FT   CDS             209769..211850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="SGO_0206"
FT                   /product="translation elongation factor G"
FT                   /note="identified by match to protein family HMM PF00009;
FT                   match to protein family HMM PF00679; match to protein
FT                   family HMM PF03144; match to protein family HMM PF03764;
FT                   match to protein family HMM TIGR00231; match to protein
FT                   family HMM TIGR00484"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10659"
FT                   /db_xref="GOA:A8AUR6"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AUR6"
FT                   /protein_id="ABV10659.1"
FT   gene            212083..213093
FT                   /gene="gap"
FT                   /locus_tag="SGO_0207"
FT   CDS             212083..213093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gap"
FT                   /locus_tag="SGO_0207"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase, type I"
FT                   /EC_number="1.2.1.-"
FT                   /note="identified by match to protein family HMM PF00044;
FT                   match to protein family HMM PF02800; match to protein
FT                   family HMM TIGR01534"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11012"
FT                   /db_xref="GOA:A8AUR7"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUR7"
FT                   /protein_id="ABV11012.1"
FT   gene            213339..218087
FT                   /locus_tag="SGO_0208"
FT   CDS             213339..218087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0208"
FT                   /product="LPXTG cell wall surface protein, glycosyl
FT                   hydrolase family"
FT                   /note="identified by match to protein family HMM PF00746;
FT                   match to protein family HMM PF03644; match to protein
FT                   family HMM PF04650; match to protein family HMM PF07523;
FT                   match to protein family HMM TIGR01167; match to protein
FT                   family HMM TIGR01168"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09481"
FT                   /db_xref="GOA:A8AUR8"
FT                   /db_xref="InterPro:IPR005201"
FT                   /db_xref="InterPro:IPR005877"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022038"
FT                   /db_xref="InterPro:IPR032979"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUR8"
FT                   /protein_id="ABV09481.1"
FT                   KED"
FT   gene            218406..219605
FT                   /gene="pgk"
FT                   /locus_tag="SGO_0209"
FT   CDS             218406..219605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgk"
FT                   /locus_tag="SGO_0209"
FT                   /product="phosphoglycerate kinase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00162"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09340"
FT                   /db_xref="GOA:A8AUR9"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AUR9"
FT                   /protein_id="ABV09340.1"
FT                   "
FT   gene            219788..224515
FT                   /gene="sspA"
FT                   /locus_tag="SGO_0210"
FT   CDS             219788..224515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sspA"
FT                   /locus_tag="SGO_0210"
FT                   /product="streptococcal surface protein A"
FT                   /note="identified by match to protein family HMM PF00746;
FT                   match to protein family HMM PF06696; match to protein
FT                   family HMM PF08363; match to protein family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10916"
FT                   /db_xref="InterPro:IPR009578"
FT                   /db_xref="InterPro:IPR013574"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR021197"
FT                   /db_xref="InterPro:IPR026345"
FT                   /db_xref="InterPro:IPR032300"
FT                   /db_xref="InterPro:IPR036234"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUS0"
FT                   /protein_id="ABV10916.1"
FT   gene            224934..229433
FT                   /gene="sspB"
FT                   /locus_tag="SGO_0211"
FT   CDS             224934..229433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sspB"
FT                   /locus_tag="SGO_0211"
FT                   /product="streptococcal surface protein B"
FT                   /note="identified by match to protein family HMM PF00746;
FT                   match to protein family HMM PF06696; match to protein
FT                   family HMM PF08363; match to protein family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10074"
FT                   /db_xref="GOA:A8AUS1"
FT                   /db_xref="InterPro:IPR009578"
FT                   /db_xref="InterPro:IPR013574"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR021197"
FT                   /db_xref="InterPro:IPR026345"
FT                   /db_xref="InterPro:IPR032300"
FT                   /db_xref="InterPro:IPR036234"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUS1"
FT                   /protein_id="ABV10074.1"
FT   gene            229679..230329
FT                   /locus_tag="SGO_0212"
FT   CDS             229679..230329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0212"
FT                   /product="putative peptidoglycan hydrolase and general
FT                   stress protein"
FT                   /note="identified by match to protein family HMM PF01476;
FT                   match to protein family HMM PF05257"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10980"
FT                   /db_xref="GOA:A8AUS2"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="InterPro:IPR009148"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUS2"
FT                   /protein_id="ABV10980.1"
FT   gene            230481..231011
FT                   /locus_tag="SGO_0213"
FT   CDS             230481..231011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0213"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10427"
FT                   /db_xref="GOA:A8AUS3"
FT                   /db_xref="InterPro:IPR010343"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUS3"
FT                   /protein_id="ABV10427.1"
FT                   NRLRSFFRKDKSK"
FT   gene            231300..231665
FT                   /locus_tag="SGO_0214"
FT   CDS             231300..231665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0214"
FT                   /product="transcription regulator, MerR family"
FT                   /note="identified by match to protein family HMM PF00376"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11019"
FT                   /db_xref="GOA:A8AUS4"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUS4"
FT                   /protein_id="ABV11019.1"
FT                   QSRFASSVPTFGQLKRP"
FT   gene            231695..233041
FT                   /gene="glnA"
FT                   /locus_tag="SGO_0215"
FT   CDS             231695..233041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnA"
FT                   /locus_tag="SGO_0215"
FT                   /product="glutamine synthetase, type I"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00120;
FT                   match to protein family HMM PF03951; match to protein
FT                   family HMM TIGR00653"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09625"
FT                   /db_xref="GOA:A8AUS5"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUS5"
FT                   /protein_id="ABV09625.1"
FT   gene            233095..233499
FT                   /locus_tag="SGO_0216"
FT   CDS             233095..233499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0216"
FT                   /product="Histone acetyltransferase HPA2"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09683"
FT                   /db_xref="GOA:A8AUS6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUS6"
FT                   /protein_id="ABV09683.1"
FT   gene            233734..235068
FT                   /locus_tag="SGO_0217"
FT   CDS             233734..235068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0217"
FT                   /product="proton-dependent manganese transporter group C
FT                   beta 2"
FT                   /note="identified by match to protein family HMM PF01566;
FT                   match to protein family HMM TIGR01197"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10905"
FT                   /db_xref="GOA:A8AUS7"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUS7"
FT                   /protein_id="ABV10905.1"
FT   gene            235277..236728
FT                   /pseudo
FT                   /locus_tag="SGO_0218"
FT                   /note="transposase, IS5 family, authentic frameshift; this
FT                   gene contains a frame shift which is not the result of
FT                   sequencing error"
FT   gene            complement(236756..238438)
FT                   /locus_tag="SGO_0219"
FT   CDS             complement(236756..238438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0219"
FT                   /product="metallo-beta-lactamase superfamily protein 1"
FT                   /note="identified by match to protein family HMM PF00753;
FT                   match to protein family HMM PF07521; match to protein
FT                   family HMM TIGR00649"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11065"
FT                   /db_xref="GOA:A8AUS8"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001587"
FT                   /db_xref="InterPro:IPR004613"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR030854"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUS8"
FT                   /protein_id="ABV11065.1"
FT   gene            complement(238442..238672)
FT                   /locus_tag="SGO_0220"
FT   CDS             complement(238442..238672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0220"
FT                   /product="Protein of unknown function (DUF1447)
FT                   superfamily"
FT                   /note="identified by match to protein family HMM PF07288"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09565"
FT                   /db_xref="InterPro:IPR009907"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AUS9"
FT                   /protein_id="ABV09565.1"
FT   gene            238949..239641
FT                   /locus_tag="SGO_0221"
FT   CDS             238949..239641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0221"
FT                   /product="glycoprotein endopeptidase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00814"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09483"
FT                   /db_xref="GOA:A8AUT0"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUT0"
FT                   /protein_id="ABV09483.1"
FT                   SDSYIQRL"
FT   gene            239590..240090
FT                   /locus_tag="SGO_0222"
FT   CDS             239590..240090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0222"
FT                   /product="ribosomal-protein-alanine N-acetyltransferase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00583;
FT                   match to protein family HMM TIGR01575"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09968"
FT                   /db_xref="GOA:A8AUT1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUT1"
FT                   /protein_id="ABV09968.1"
FT                   HER"
FT   gene            240080..241090
FT                   /locus_tag="SGO_0223"
FT   CDS             240080..241090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0223"
FT                   /product="glycoproteinase family protein"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00814;
FT                   match to protein family HMM TIGR00329"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10676"
FT                   /db_xref="GOA:A8AUT2"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AUT2"
FT                   /protein_id="ABV10676.1"
FT   gene            241100..241795
FT                   /locus_tag="SGO_0224"
FT   CDS             241100..241795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0224"
FT                   /product="transport protein-like protein"
FT                   /note="identified by match to protein family HMM PF03591"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10295"
FT                   /db_xref="GOA:A8AUT3"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUT3"
FT                   /protein_id="ABV10295.1"
FT                   TVGVLLDDK"
FT   gene            241785..242117
FT                   /locus_tag="SGO_0225"
FT   CDS             241785..242117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0225"
FT                   /product="integral membrane protein"
FT                   /note="identified by match to protein family HMM PF05437"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09142"
FT                   /db_xref="GOA:A8AUT4"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUT4"
FT                   /protein_id="ABV09142.1"
FT                   LVIQMI"
FT   gene            242226..242972
FT                   /locus_tag="SGO_0226"
FT   CDS             242226..242972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0226"
FT                   /product="methyltransferase"
FT                   /note="identified by match to protein family HMM PF08241;
FT                   match to protein family HMM PF08242"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09874"
FT                   /db_xref="GOA:A8AUT5"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUT5"
FT                   /protein_id="ABV09874.1"
FT   gene            243271..243939
FT                   /locus_tag="SGO_0227"
FT   CDS             243271..243939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0227"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10307"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUT6"
FT                   /protein_id="ABV10307.1"
FT                   "
FT   gene            244040..244780
FT                   /locus_tag="SGO_0228"
FT   CDS             244040..244780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0228"
FT                   /product="transcription regulator, MerR family"
FT                   /note="identified by match to protein family HMM PF00376;
FT                   match to protein family HMM PF07739; match to protein
FT                   family HMM PF09278"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09523"
FT                   /db_xref="GOA:A8AUT7"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012925"
FT                   /db_xref="InterPro:IPR036244"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUT7"
FT                   /protein_id="ABV09523.1"
FT   gene            complement(244836..246011)
FT                   /locus_tag="SGO_0229"
FT   CDS             complement(244836..246011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0229"
FT                   /product="conserved hypothetical protein TIGR00275"
FT                   /note="identified by match to protein family HMM PF01266;
FT                   match to protein family HMM PF03486; match to protein
FT                   family HMM PF07992; match to protein family HMM TIGR00275"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10128"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUT8"
FT                   /protein_id="ABV10128.1"
FT   gene            246230..246772
FT                   /locus_tag="SGO_0230"
FT   CDS             246230..246772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0230"
FT                   /product="Protein of unknown function, DUF536 family"
FT                   /note="identified by match to protein family HMM PF04394;
FT                   match to protein family HMM PF08279"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10870"
FT                   /db_xref="InterPro:IPR007489"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUT9"
FT                   /protein_id="ABV10870.1"
FT                   QVQQQENKGFWARLFGK"
FT   gene            246828..248588
FT                   /locus_tag="SGO_0231"
FT   CDS             246828..248588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0231"
FT                   /product="glycerophosphoryl diester phosphodiesterase
FT                   family protein"
FT                   /note="identified by match to protein family HMM PF03009"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10402"
FT                   /db_xref="GOA:A8AUU0"
FT                   /db_xref="InterPro:IPR004129"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR018476"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUU0"
FT                   /protein_id="ABV10402.1"
FT                   AADLLNFPGS"
FT   gene            complement(248630..248989)
FT                   /locus_tag="SGO_0232"
FT   CDS             complement(248630..248989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0232"
FT                   /product="conserved hypothetical protein TIGR00103"
FT                   /note="identified by match to protein family HMM PF02575;
FT                   match to protein family HMM TIGR00103"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10681"
FT                   /db_xref="GOA:A8AUU1"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUU1"
FT                   /protein_id="ABV10681.1"
FT                   ATKKKMGAFAGKLPF"
FT   gene            249121..249528
FT                   /locus_tag="SGO_0233"
FT   CDS             249121..249528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0233"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09967"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUU2"
FT                   /protein_id="ABV09967.1"
FT   gene            complement(249561..251840)
FT                   /gene="pepX"
FT                   /locus_tag="SGO_0234"
FT   CDS             complement(249561..251840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepX"
FT                   /locus_tag="SGO_0234"
FT                   /product="X-Pro dipeptidyl-peptidase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF02129;
FT                   match to protein family HMM PF08530; match to protein
FT                   family HMM PF09168"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10773"
FT                   /db_xref="GOA:A8AUU3"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR008252"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013736"
FT                   /db_xref="InterPro:IPR015251"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036313"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AUU3"
FT                   /protein_id="ABV10773.1"
FT                   LPHKKS"
FT   gene            251944..252795
FT                   /locus_tag="SGO_0235"
FT   CDS             251944..252795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0235"
FT                   /product="glycerol uptake facilitator protein-like protein"
FT                   /note="identified by match to protein family HMM PF00230"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10664"
FT                   /db_xref="GOA:A8AUU4"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUU4"
FT                   /protein_id="ABV10664.1"
FT                   YG"
FT   gene            252936..254216
FT                   /locus_tag="SGO_0236"
FT   CDS             252936..254216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0236"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09846"
FT                   /db_xref="GOA:A8AUU5"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUU5"
FT                   /protein_id="ABV09846.1"
FT   gene            254344..255081
FT                   /gene="ccpA"
FT                   /locus_tag="SGO_0237"
FT   CDS             254344..255081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccpA"
FT                   /locus_tag="SGO_0237"
FT                   /product="CcpA protein (proteinase)"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09138"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR032702"
FT                   /db_xref="InterPro:IPR032703"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUU6"
FT                   /protein_id="ABV09138.1"
FT   gene            255078..256013
FT                   /locus_tag="SGO_0238"
FT   CDS             255078..256013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0238"
FT                   /product="beta-lactamase-like or putative esterase"
FT                   /note="identified by match to protein family HMM PF00144"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10403"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUU7"
FT                   /protein_id="ABV10403.1"
FT   gene            256144..257022
FT                   /gene="mvk"
FT                   /locus_tag="SGO_0239"
FT   CDS             256144..257022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mvk"
FT                   /locus_tag="SGO_0239"
FT                   /product="mevalonate kinase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00288;
FT                   match to protein family HMM PF08544; match to protein
FT                   family HMM TIGR00549"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09841"
FT                   /db_xref="GOA:A8AUU8"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006205"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUU8"
FT                   /protein_id="ABV09841.1"
FT                   KGAINTWIESL"
FT   gene            257004..257951
FT                   /gene="mvaD"
FT                   /locus_tag="SGO_0240"
FT   CDS             257004..257951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mvaD"
FT                   /locus_tag="SGO_0240"
FT                   /product="diphosphomevalonate decarboxylase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00288;
FT                   match to protein family HMM PF08544; match to protein
FT                   family HMM TIGR01240"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09606"
FT                   /db_xref="GOA:A8AUU9"
FT                   /db_xref="InterPro:IPR005935"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR029765"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUU9"
FT                   /protein_id="ABV09606.1"
FT   gene            257941..258960
FT                   /locus_tag="SGO_0241"
FT   CDS             257941..258960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0241"
FT                   /product="phosphomevalonate kinase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00288;
FT                   match to protein family HMM PF08544; match to protein
FT                   family HMM TIGR01220"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10190"
FT                   /db_xref="GOA:A8AUV0"
FT                   /db_xref="InterPro:IPR005917"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR035102"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUV0"
FT                   /protein_id="ABV10190.1"
FT   gene            258944..259948
FT                   /locus_tag="SGO_0242"
FT   CDS             258944..259948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0242"
FT                   /product="FMN-dependent dehydrogenase family protein"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01070;
FT                   match to protein family HMM TIGR02151"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10499"
FT                   /db_xref="GOA:A8AUV1"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR011179"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AUV1"
FT                   /protein_id="ABV10499.1"
FT   gene            complement(259985..261259)
FT                   /locus_tag="SGO_0243"
FT   CDS             complement(259985..261259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0243"
FT                   /product="hydroxymethylglutaryl-CoA reductase, degradative"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM TIGR00532"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10070"
FT                   /db_xref="GOA:A8AUV2"
FT                   /db_xref="InterPro:IPR002202"
FT                   /db_xref="InterPro:IPR004553"
FT                   /db_xref="InterPro:IPR009023"
FT                   /db_xref="InterPro:IPR009029"
FT                   /db_xref="InterPro:IPR023074"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUV2"
FT                   /protein_id="ABV10070.1"
FT   gene            complement(261256..262434)
FT                   /locus_tag="SGO_0244"
FT   CDS             complement(261256..262434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0244"
FT                   /product="hydroxymethylglutaryl-CoA synthase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01154;
FT                   match to protein family HMM PF08540; match to protein
FT                   family HMM TIGR01835"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09984"
FT                   /db_xref="GOA:A8AUV3"
FT                   /db_xref="InterPro:IPR011554"
FT                   /db_xref="InterPro:IPR013528"
FT                   /db_xref="InterPro:IPR013746"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUV3"
FT                   /protein_id="ABV09984.1"
FT   gene            complement(262622..263077)
FT                   /locus_tag="SGO_0245"
FT   CDS             complement(262622..263077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0245"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11008"
FT                   /db_xref="GOA:A8AUV4"
FT                   /db_xref="InterPro:IPR024528"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUV4"
FT                   /protein_id="ABV11008.1"
FT   gene            complement(263082..263840)
FT                   /locus_tag="SGO_0246"
FT   CDS             complement(263082..263840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0246"
FT                   /product="membrane spanning protein"
FT                   /note="identified by match to protein family HMM PF06738"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10262"
FT                   /db_xref="GOA:A8AUV5"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUV5"
FT                   /protein_id="ABV10262.1"
FT   gene            complement(263978..266293)
FT                   /gene="pfl"
FT                   /locus_tag="SGO_0247"
FT   CDS             complement(263978..266293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfl"
FT                   /locus_tag="SGO_0247"
FT                   /product="formate acetyltransferase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01228;
FT                   match to protein family HMM PF02901; match to protein
FT                   family HMM TIGR01255"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09813"
FT                   /db_xref="GOA:A8AUV6"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR004184"
FT                   /db_xref="InterPro:IPR005949"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUV6"
FT                   /protein_id="ABV09813.1"
FT                   ELTQRVFHEVLSMDDALS"
FT   gene            266543..267607
FT                   /locus_tag="SGO_0248"
FT   CDS             266543..267607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0248"
FT                   /product="DNA-damage-inducible protein P"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00817"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09189"
FT                   /db_xref="GOA:A8AUV7"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR024728"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AUV7"
FT                   /protein_id="ABV09189.1"
FT                   RGIRLLGLTVTGFE"
FT   gene            267819..268145
FT                   /locus_tag="SGO_0249"
FT   CDS             267819..268145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0249"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10683"
FT                   /db_xref="GOA:A8AUV8"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUV8"
FT                   /protein_id="ABV10683.1"
FT                   ERSK"
FT   gene            268464..268940
FT                   /locus_tag="SGO_0250"
FT   CDS             268464..268940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0250"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10524"
FT                   /db_xref="GOA:A8AUV9"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUV9"
FT                   /protein_id="ABV10524.1"
FT   gene            268892..269641
FT                   /locus_tag="SGO_0251"
FT   CDS             268892..269641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0251"
FT                   /product="CAAX amino terminal protease family"
FT                   /note="identified by match to protein family HMM PF02517"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10957"
FT                   /db_xref="GOA:A8AUW0"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUW0"
FT                   /protein_id="ABV10957.1"
FT   gene            269717..270355
FT                   /locus_tag="SGO_0252"
FT   CDS             269717..270355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0252"
FT                   /product="possible TetR-type transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09598"
FT                   /db_xref="GOA:A8AUW1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUW1"
FT                   /protein_id="ABV09598.1"
FT   gene            complement(270660..271604)
FT                   /locus_tag="SGO_0253"
FT   CDS             complement(270660..271604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0253"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10090"
FT                   /db_xref="GOA:A8AUW2"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUW2"
FT                   /protein_id="ABV10090.1"
FT   gene            complement(271661..274027)
FT                   /locus_tag="SGO_0254"
FT   CDS             complement(271661..274027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0254"
FT                   /product="helicase, RecD/TraA family"
FT                   /note="identified by match to protein family HMM TIGR01448"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09553"
FT                   /db_xref="GOA:A8AUW3"
FT                   /db_xref="InterPro:IPR006345"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="InterPro:IPR029493"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUW3"
FT                   /protein_id="ABV09553.1"
FT   gene            complement(274122..274724)
FT                   /locus_tag="SGO_0255"
FT   CDS             complement(274122..274724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0255"
FT                   /product="Signal peptidase I"
FT                   /note="identified by match to protein family HMM PF00717;
FT                   match to protein family HMM TIGR02227"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10715"
FT                   /db_xref="GOA:A8AUW4"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUW4"
FT                   /protein_id="ABV10715.1"
FT   gene            complement(274728..275618)
FT                   /gene="rnhC"
FT                   /locus_tag="SGO_0256"
FT   CDS             complement(274728..275618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhC"
FT                   /locus_tag="SGO_0256"
FT                   /product="ribonuclease HIII"
FT                   /EC_number="3.1.26.-"
FT                   /note="identified by match to protein family HMM PF01351;
FT                   match to protein family HMM TIGR00716"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09215"
FT                   /db_xref="GOA:A8AUW5"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR004641"
FT                   /db_xref="InterPro:IPR012295"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR024568"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AUW5"
FT                   /protein_id="ABV09215.1"
FT                   LHFKNTQKAKQLLER"
FT   gene            275610..275726
FT                   /locus_tag="SGO_0257"
FT   CDS             275610..275726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0257"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09796"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUW6"
FT                   /protein_id="ABV09796.1"
FT   gene            275768..276073
FT                   /locus_tag="SGO_0258"
FT   CDS             275768..276073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0258"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10349"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUW7"
FT                   /protein_id="ABV10349.1"
FT   gene            276070..276621
FT                   /gene="cvpA"
FT                   /locus_tag="SGO_0259"
FT   CDS             276070..276621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cvpA"
FT                   /locus_tag="SGO_0259"
FT                   /product="CvpA family protein"
FT                   /note="identified by match to protein family HMM PF02674"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09303"
FT                   /db_xref="GOA:A8AUW8"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUW8"
FT                   /protein_id="ABV09303.1"
FT   gene            276677..279010
FT                   /locus_tag="SGO_0260"
FT   CDS             276677..279010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0260"
FT                   /product="DNA mismatch binding protein MutS2"
FT                   /note="identified by match to protein family HMM PF00488;
FT                   match to protein family HMM PF01713; match to protein
FT                   family HMM TIGR01069"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09884"
FT                   /db_xref="GOA:A8AUW9"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR005747"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AUW9"
FT                   /protein_id="ABV09884.1"
FT   gene            279021..279665
FT                   /locus_tag="SGO_0261"
FT   CDS             279021..279665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0261"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11130"
FT                   /db_xref="GOA:A8AUX0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUX0"
FT                   /protein_id="ABV11130.1"
FT   gene            279766..281184
FT                   /locus_tag="SGO_0262"
FT   CDS             279766..281184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0262"
FT                   /product="dipeptidase"
FT                   /EC_number="3.4.-.-"
FT                   /note="identified by match to protein family HMM PF03577"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10717"
FT                   /db_xref="GOA:A8AUX1"
FT                   /db_xref="InterPro:IPR005322"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUX1"
FT                   /protein_id="ABV10717.1"
FT                   DASNLMTNHFSLSD"
FT   gene            281269..281583
FT                   /gene="trx-1"
FT                   /locus_tag="SGO_0263"
FT   CDS             281269..281583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trx-1"
FT                   /locus_tag="SGO_0263"
FT                   /product="thioredoxin"
FT                   /note="identified by match to protein family HMM PF00085;
FT                   match to protein family HMM PF08534; match to protein
FT                   family HMM TIGR01068"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09921"
FT                   /db_xref="GOA:A8AUX2"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUX2"
FT                   /protein_id="ABV09921.1"
FT                   "
FT   gene            complement(281745..282263)
FT                   /locus_tag="SGO_0264"
FT   CDS             complement(281745..282263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0264"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10590"
FT                   /db_xref="InterPro:IPR032349"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUX3"
FT                   /protein_id="ABV10590.1"
FT                   TFEILHISQ"
FT   gene            282372..283118
FT                   /gene="nac"
FT                   /locus_tag="SGO_0265"
FT   CDS             282372..283118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nac"
FT                   /locus_tag="SGO_0265"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10824"
FT                   /db_xref="GOA:A8AUX4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUX4"
FT                   /protein_id="ABV10824.1"
FT   gene            283218..283625
FT                   /locus_tag="SGO_0266"
FT   CDS             283218..283625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0266"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09306"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUX5"
FT                   /protein_id="ABV09306.1"
FT   gene            283883..285322
FT                   /locus_tag="SGO_0267"
FT   CDS             283883..285322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0267"
FT                   /product="amino acid permease family protein"
FT                   /note="identified by match to protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10701"
FT                   /db_xref="GOA:A8AUX6"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUX6"
FT                   /protein_id="ABV10701.1"
FT   gene            285466..286305
FT                   /locus_tag="SGO_0268"
FT   CDS             285466..286305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0268"
FT                   /product="mechanosensitive transport protein"
FT                   /note="identified by match to protein family HMM PF00924"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10126"
FT                   /db_xref="GOA:A8AUX7"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUX7"
FT                   /protein_id="ABV10126.1"
FT   gene            286342..286956
FT                   /locus_tag="SGO_0269"
FT   CDS             286342..286956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0269"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11119"
FT                   /db_xref="GOA:A8AUX8"
FT                   /db_xref="InterPro:IPR029050"
FT                   /db_xref="InterPro:IPR029051"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUX8"
FT                   /protein_id="ABV11119.1"
FT   gene            complement(287036..288250)
FT                   /gene="gltP"
FT                   /locus_tag="SGO_0270"
FT   CDS             complement(287036..288250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltP"
FT                   /locus_tag="SGO_0270"
FT                   /product="sodium:dicarboxylate symporter family protein"
FT                   /note="identified by match to protein family HMM PF00375"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10434"
FT                   /db_xref="GOA:A8AUX9"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR023025"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUX9"
FT                   /protein_id="ABV10434.1"
FT                   PKEKL"
FT   gene            288632..289534
FT                   /locus_tag="SGO_0271"
FT   CDS             288632..289534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0271"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09835"
FT                   /db_xref="InterPro:IPR018728"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUY0"
FT                   /protein_id="ABV09835.1"
FT   gene            289599..289967
FT                   /locus_tag="SGO_0272"
FT   CDS             289599..289967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0272"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09494"
FT                   /db_xref="InterPro:IPR027580"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUY1"
FT                   /protein_id="ABV09494.1"
FT                   EKLKEKQSAGKFFEKLDI"
FT   gene            290379..291383
FT                   /locus_tag="SGO_0273"
FT   CDS             290379..291383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0273"
FT                   /product="zinc-binding oxidoreductase"
FT                   /note="identified by match to protein family HMM PF08240"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10186"
FT                   /db_xref="GOA:A8AUY2"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUY2"
FT                   /protein_id="ABV10186.1"
FT   gene            291400..292044
FT                   /locus_tag="SGO_0274"
FT   CDS             291400..292044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0274"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09862"
FT                   /db_xref="GOA:A8AUY3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUY3"
FT                   /protein_id="ABV09862.1"
FT   gene            complement(292331..292816)
FT                   /locus_tag="SGO_0275"
FT   CDS             complement(292331..292816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0275"
FT                   /product="transcriptional regulator, MarR family"
FT                   /EC_number="2.3.1.-"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09375"
FT                   /db_xref="GOA:A8AUY4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUY4"
FT                   /protein_id="ABV09375.1"
FT   gene            complement(292848..294194)
FT                   /gene="gdhA"
FT                   /locus_tag="SGO_0276"
FT   CDS             complement(292848..294194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gdhA"
FT                   /locus_tag="SGO_0276"
FT                   /product="glutamate dehydrogenase (NADP)"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00208;
FT                   match to protein family HMM PF02812"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10748"
FT                   /db_xref="GOA:A8AUY5"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUY5"
FT                   /protein_id="ABV10748.1"
FT   gene            294430..295368
FT                   /gene="pyrA"
FT                   /locus_tag="SGO_0277"
FT   CDS             294430..295368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrA"
FT                   /locus_tag="SGO_0277"
FT                   /product="Dihydroorotate dehydrogenase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01180;
FT                   match to protein family HMM TIGR01037"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09467"
FT                   /db_xref="GOA:A8AUY6"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR012135"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024920"
FT                   /db_xref="InterPro:IPR033886"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUY6"
FT                   /protein_id="ABV09467.1"
FT   gene            295532..296467
FT                   /gene="msrA"
FT                   /locus_tag="SGO_0278"
FT   CDS             295532..296467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msrA"
FT                   /locus_tag="SGO_0278"
FT                   /product="Peptide methionine sulfoxide reductase msrA/msrB"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01625;
FT                   match to protein family HMM PF01641; match to protein
FT                   family HMM TIGR00357; match to protein family HMM
FT                   TIGR00401"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11083"
FT                   /db_xref="GOA:Q9LAM9"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LAM9"
FT                   /protein_id="ABV11083.1"
FT   gene            296552..297238
FT                   /locus_tag="SGO_0279"
FT   CDS             296552..297238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0279"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10163"
FT                   /db_xref="InterPro:IPR032542"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUY8"
FT                   /protein_id="ABV10163.1"
FT                   DYLNFE"
FT   gene            297405..298601
FT                   /gene="trzA"
FT                   /locus_tag="SGO_0280"
FT   CDS             297405..298601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trzA"
FT                   /locus_tag="SGO_0280"
FT                   /product="ethylammeline chlorohydrolase"
FT                   /note="identified by match to protein family HMM PF01979;
FT                   match to protein family HMM PF07969"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09521"
FT                   /db_xref="GOA:A8AUY9"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUY9"
FT                   /protein_id="ABV09521.1"
FT   gene            298883..300772
FT                   /locus_tag="SGO_0281"
FT   CDS             298883..300772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0281"
FT                   /product="PTS system, beta-glucoside-specific IIABC
FT                   component"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00358;
FT                   match to protein family HMM PF00367; match to protein
FT                   family HMM PF02378; match to protein family HMM TIGR00830;
FT                   match to protein family HMM TIGR01995"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10730"
FT                   /db_xref="GOA:A8AUZ0"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR011297"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUZ0"
FT                   /protein_id="ABV10730.1"
FT   gene            300929..302191
FT                   /locus_tag="SGO_0282"
FT   CDS             300929..302191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0282"
FT                   /product="cell wall polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10884"
FT                   /db_xref="GOA:A8AUZ1"
FT                   /db_xref="InterPro:IPR019079"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUZ1"
FT                   /protein_id="ABV10884.1"
FT   gene            302294..302521
FT                   /locus_tag="SGO_0283"
FT   CDS             302294..302521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0283"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10452"
FT                   /db_xref="GOA:A8AUZ2"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUZ2"
FT                   /protein_id="ABV10452.1"
FT   gene            complement(302843..303715)
FT                   /locus_tag="SGO_0284"
FT   CDS             complement(302843..303715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0284"
FT                   /product="transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00165;
FT                   match to protein family HMM PF02311; match to protein
FT                   family HMM PF07883"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09988"
FT                   /db_xref="GOA:A8AUZ3"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUZ3"
FT                   /protein_id="ABV09988.1"
FT                   MTPRQYRKK"
FT   gene            303826..305262
FT                   /gene="pbg"
FT                   /locus_tag="SGO_0285"
FT   CDS             303826..305262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbg"
FT                   /locus_tag="SGO_0285"
FT                   /product="phospho beta-glucosidase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00232"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10576"
FT                   /db_xref="GOA:A8AUZ4"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="InterPro:IPR033132"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUZ4"
FT                   /protein_id="ABV10576.1"
FT   gene            305385..307055
FT                   /locus_tag="SGO_0286"
FT   CDS             305385..307055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0286"
FT                   /product="DNA mismatch repair protein MutS, putative"
FT                   /note="identified by match to protein family HMM PF00488"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10107"
FT                   /db_xref="GOA:A8AUZ5"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUZ5"
FT                   /protein_id="ABV10107.1"
FT   gene            307052..307879
FT                   /locus_tag="SGO_0287"
FT   CDS             307052..307879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0287"
FT                   /product="haloacid dehalogenase-like hydrolase, putative"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM PF05116; match to protein
FT                   family HMM PF08282; match to protein family HMM TIGR00099;
FT                   match to protein family HMM TIGR01484"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10300"
FT                   /db_xref="GOA:A8AUZ6"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUZ6"
FT                   /protein_id="ABV10300.1"
FT   gene            307932..308516
FT                   /locus_tag="SGO_0288"
FT   CDS             307932..308516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0288"
FT                   /product="GDSL-like lipase/acylhydrolase"
FT                   /EC_number=""
FT                   /note="identified by similarity to GB:AAM99985.1; match to
FT                   protein family HMM PF00657"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10727"
FT                   /db_xref="GOA:A8AUZ7"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUZ7"
FT                   /protein_id="ABV10727.1"
FT   gene            308665..309060
FT                   /locus_tag="SGO_0289"
FT   CDS             308665..309060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0289"
FT                   /product="COPAB ATPases metal-fist type repressor"
FT                   /note="identified by match to protein family HMM PF03965;
FT                   match to protein family HMM TIGR02698"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11092"
FT                   /db_xref="GOA:A8AUZ8"
FT                   /db_xref="InterPro:IPR005650"
FT                   /db_xref="InterPro:IPR014071"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUZ8"
FT                   /protein_id="ABV11092.1"
FT   gene            309079..309450
FT                   /locus_tag="SGO_0290"
FT   CDS             309079..309450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0290"
FT                   /product="copper-translocating P-type ATPase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09477"
FT                   /db_xref="GOA:A8AUZ9"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="UniProtKB/TrEMBL:A8AUZ9"
FT                   /protein_id="ABV09477.1"
FT   gene            309461..311683
FT                   /locus_tag="SGO_0291"
FT   CDS             309461..311683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0291"
FT                   /product="copper-translocating P-type ATPase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00122;
FT                   match to protein family HMM PF00702; match to protein
FT                   family HMM PF08282; match to protein family HMM TIGR01494;
FT                   match to protein family HMM TIGR01511; match to protein
FT                   family HMM TIGR01525"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09370"
FT                   /db_xref="GOA:A8AV00"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV00"
FT                   /protein_id="ABV09370.1"
FT   gene            312135..313910
FT                   /gene="spxB"
FT                   /locus_tag="SGO_0292"
FT   CDS             312135..313910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spxB"
FT                   /locus_tag="SGO_0292"
FT                   /product="pyruvate oxidase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00205;
FT                   match to protein family HMM PF02775; match to protein
FT                   family HMM PF02776; match to protein family HMM TIGR02720"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09788"
FT                   /db_xref="GOA:A8AV01"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR014092"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV01"
FT                   /protein_id="ABV09788.1"
FT                   RLFLEEEGLQSRAIK"
FT   gene            314064..314411
FT                   /locus_tag="SGO_0293"
FT   CDS             314064..314411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0293"
FT                   /product="glyoxalase family protein superfamily"
FT                   /note="identified by match to protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10229"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV02"
FT                   /protein_id="ABV10229.1"
FT                   AGLVIDFYRMK"
FT   gene            314953..316527
FT                   /locus_tag="SGO_0294"
FT   CDS             314953..316527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0294"
FT                   /product="ABC transporter, putative"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10700"
FT                   /db_xref="GOA:A8AV03"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV03"
FT                   /protein_id="ABV10700.1"
FT                   VVDLGKY"
FT   gene            316618..316785
FT                   /locus_tag="SGO_0295"
FT   CDS             316618..316785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0295"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09214"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV04"
FT                   /protein_id="ABV09214.1"
FT                   SKNERGFENV"
FT   gene            316778..317038
FT                   /locus_tag="SGO_0296"
FT   CDS             316778..317038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0296"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09804"
FT                   /db_xref="GOA:A8AV05"
FT                   /db_xref="InterPro:IPR004316"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV05"
FT                   /protein_id="ABV09804.1"
FT   gene            317247..318686
FT                   /locus_tag="SGO_0297"
FT   CDS             317247..318686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0297"
FT                   /product="6-phospho-beta-glucosidase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00232"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11096"
FT                   /db_xref="GOA:A8AV06"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="InterPro:IPR033132"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV06"
FT                   /protein_id="ABV11096.1"
FT   gene            319070..319750
FT                   /locus_tag="SGO_0298"
FT   CDS             319070..319750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0298"
FT                   /product="two-component response regulator, putative"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09238"
FT                   /db_xref="GOA:A8AV07"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV07"
FT                   /protein_id="ABV09238.1"
FT                   LKED"
FT   gene            319751..320626
FT                   /locus_tag="SGO_0299"
FT   CDS             319751..320626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0299"
FT                   /product="putative histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09722"
FT                   /db_xref="GOA:A8AV08"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV08"
FT                   /protein_id="ABV09722.1"
FT                   DDWFELRVSL"
FT   gene            complement(320833..321555)
FT                   /locus_tag="SGO_0300"
FT   CDS             complement(320833..321555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0300"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11122"
FT                   /db_xref="GOA:A8AV09"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV09"
FT                   /protein_id="ABV11122.1"
FT                   LITVFSLAGLATLKKRDL"
FT   gene            complement(321548..322480)
FT                   /locus_tag="SGO_0301"
FT   CDS             complement(321548..322480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0301"
FT                   /product="ABC transporter ATP-binding protein-like protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09881"
FT                   /db_xref="GOA:A8AV10"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV10"
FT                   /protein_id="ABV09881.1"
FT   gene            complement(322628..323323)
FT                   /locus_tag="SGO_0302"
FT   CDS             complement(322628..323323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0302"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09959"
FT                   /db_xref="GOA:A8AV11"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV11"
FT                   /protein_id="ABV09959.1"
FT                   LYTFHKKDL"
FT   gene            complement(323336..324244)
FT                   /locus_tag="SGO_0303"
FT   CDS             complement(323336..324244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0303"
FT                   /product="ABC transporter ATP-binding protein-like protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10088"
FT                   /db_xref="GOA:A8AV12"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV12"
FT                   /protein_id="ABV10088.1"
FT   gene            complement(324387..325079)
FT                   /locus_tag="SGO_0304"
FT   CDS             complement(324387..325079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0304"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10185"
FT                   /db_xref="GOA:A8AV13"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV13"
FT                   /protein_id="ABV10185.1"
FT                   QAFQHRDL"
FT   gene            complement(325117..325875)
FT                   /locus_tag="SGO_0305"
FT   CDS             complement(325117..325875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0305"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10645"
FT                   /db_xref="GOA:A8AV14"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV14"
FT                   /protein_id="ABV10645.1"
FT   gene            complement(325892..326800)
FT                   /locus_tag="SGO_0306"
FT   CDS             complement(325892..326800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0306"
FT                   /product="ABC transporter ATP-binding protein-like protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11086"
FT                   /db_xref="GOA:A8AV15"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV15"
FT                   /protein_id="ABV11086.1"
FT   gene            complement(327021..328700)
FT                   /gene="pabB"
FT                   /locus_tag="SGO_0307"
FT   CDS             complement(327021..328700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabB"
FT                   /locus_tag="SGO_0307"
FT                   /product="chorismate binding enzyme"
FT                   /EC_number="4.1.3.-"
FT                   /note="identified by match to protein family HMM PF00425;
FT                   match to protein family HMM TIGR00553"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10871"
FT                   /db_xref="GOA:A8AV16"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR005802"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV16"
FT                   /protein_id="ABV10871.1"
FT   gene            328713..328805
FT                   /locus_tag="SGO_0308"
FT   CDS             328713..328805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0308"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09931"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV17"
FT                   /protein_id="ABV09931.1"
FT                   /translation="MAQLLKINNRFLVHKVILSQDNLNENGFIW"
FT   gene            328887..329258
FT                   /locus_tag="SGO_0309"
FT   CDS             328887..329258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0309"
FT                   /product="insulin activator factor"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10419"
FT                   /db_xref="GOA:A8AV18"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV18"
FT                   /protein_id="ABV10419.1"
FT   gene            329538..331790
FT                   /gene="metE"
FT                   /locus_tag="SGO_0310"
FT   CDS             329538..331790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metE"
FT                   /locus_tag="SGO_0310"
FT                   /product="5-methyltetrahydropteroyltriglutamate--homocysteine
FT                   S-methyltransferase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01717;
FT                   match to protein family HMM PF08267; match to protein
FT                   family HMM TIGR01371"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10872"
FT                   /db_xref="GOA:A8AV19"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR006276"
FT                   /db_xref="InterPro:IPR013215"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AV19"
FT                   /protein_id="ABV10872.1"
FT   gene            331928..332782
FT                   /gene="metF"
FT                   /locus_tag="SGO_0311"
FT   CDS             331928..332782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metF"
FT                   /locus_tag="SGO_0311"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /note="identified by match to protein family HMM PF02219;
FT                   match to protein family HMM TIGR00676"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09209"
FT                   /db_xref="GOA:A8AV20"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV20"
FT                   /protein_id="ABV09209.1"
FT                   FFS"
FT   gene            333239..335623
FT                   /gene="xfp"
FT                   /locus_tag="SGO_0312"
FT   CDS             333239..335623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xfp"
FT                   /locus_tag="SGO_0312"
FT                   /product="D-xylulose 5-phosphate/D-fructose 6-phosphate
FT                   phosphoketolase"
FT                   /note="identified by match to protein family HMM PF03894"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09698"
FT                   /db_xref="GOA:A8AV21"
FT                   /db_xref="InterPro:IPR005593"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR018969"
FT                   /db_xref="InterPro:IPR018970"
FT                   /db_xref="InterPro:IPR019789"
FT                   /db_xref="InterPro:IPR019790"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV21"
FT                   /protein_id="ABV09698.1"
FT   gene            335846..336688
FT                   /locus_tag="SGO_0313"
FT   CDS             335846..336688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0313"
FT                   /product="HAD superfamily hydrolase"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM PF08282; match to protein
FT                   family HMM TIGR00099; match to protein family HMM
FT                   TIGR01484"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09275"
FT                   /db_xref="GOA:A8AV22"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV22"
FT                   /protein_id="ABV09275.1"
FT   gene            336700..337296
FT                   /locus_tag="SGO_0314"
FT   CDS             336700..337296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0314"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /note="identified by match to protein family HMM PF00300"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10082"
FT                   /db_xref="GOA:A8AV23"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV23"
FT                   /protein_id="ABV10082.1"
FT   gene            337293..337904
FT                   /locus_tag="SGO_0315"
FT   CDS             337293..337904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0315"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /note="identified by match to protein family HMM PF00300"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10836"
FT                   /db_xref="GOA:A8AV24"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV24"
FT                   /protein_id="ABV10836.1"
FT   gene            338351..342835
FT                   /locus_tag="SGO_0316"
FT   CDS             338351..342835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0316"
FT                   /product="LPXTG cell wall surface protein, serine protease,
FT                   subtilase family"
FT                   /EC_number="3.4.21.-"
FT                   /note="identified by match to protein family HMM PF00082;
FT                   match to protein family HMM PF02225; match to protein
FT                   family HMM PF04650; match to protein family HMM PF06280;
FT                   match to protein family HMM TIGR01167; match to protein
FT                   family HMM TIGR01168"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10987"
FT                   /db_xref="GOA:A8AV25"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR005877"
FT                   /db_xref="InterPro:IPR010435"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034216"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV25"
FT                   /protein_id="ABV10987.1"
FT   gene            342920..347404
FT                   /locus_tag="SGO_0317"
FT   CDS             342920..347404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0317"
FT                   /product="LPXTG cell wall surface protein, serine protease,
FT                   subtilase family"
FT                   /EC_number="3.4.21.-"
FT                   /note="identified by match to protein family HMM PF00082;
FT                   match to protein family HMM PF00746; match to protein
FT                   family HMM PF02225; match to protein family HMM PF04650;
FT                   match to protein family HMM PF06280; match to protein
FT                   family HMM TIGR01167; match to protein family HMM
FT                   TIGR01168"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09636"
FT                   /db_xref="GOA:A8AV26"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR005877"
FT                   /db_xref="InterPro:IPR010435"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034216"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV26"
FT                   /protein_id="ABV09636.1"
FT   gene            complement(347496..347912)
FT                   /locus_tag="SGO_0318"
FT   CDS             complement(347496..347912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0318"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10671"
FT                   /db_xref="GOA:A8AV27"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV27"
FT                   /protein_id="ABV10671.1"
FT   gene            complement(347893..348792)
FT                   /locus_tag="SGO_0319"
FT   CDS             complement(347893..348792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0319"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11095"
FT                   /db_xref="InterPro:IPR018711"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV28"
FT                   /protein_id="ABV11095.1"
FT                   TNGNISERAVSDIVYIGY"
FT   gene            complement(348789..349832)
FT                   /locus_tag="SGO_0320"
FT   CDS             complement(348789..349832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0320"
FT                   /product="Dolichol-phosphate mannosyltransferase"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09234"
FT                   /db_xref="GOA:A8AV29"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV29"
FT                   /protein_id="ABV09234.1"
FT                   ERTHTVS"
FT   gene            complement(350062..350676)
FT                   /locus_tag="SGO_0321"
FT   CDS             complement(350062..350676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0321"
FT                   /product="polypeptide deformylase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01327;
FT                   match to protein family HMM TIGR00079"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09658"
FT                   /db_xref="GOA:A8AV30"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AV30"
FT                   /protein_id="ABV09658.1"
FT   gene            350832..351974
FT                   /locus_tag="SGO_0322"
FT   CDS             350832..351974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0322"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09410"
FT                   /db_xref="GOA:A8AV31"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV31"
FT                   /protein_id="ABV09410.1"
FT   gene            351976..352704
FT                   /locus_tag="SGO_0323"
FT   CDS             351976..352704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0323"
FT                   /product="pseudouridine synthase rRNA-specific"
FT                   /note="identified by match to protein family HMM PF00849;
FT                   match to protein family HMM PF01479; match to protein
FT                   family HMM TIGR00093"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09808"
FT                   /db_xref="GOA:A8AV32"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV32"
FT                   /protein_id="ABV09808.1"
FT   gene            353178..354959
FT                   /locus_tag="SGO_0324"
FT   CDS             353178..354959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0324"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09800"
FT                   /db_xref="GOA:A8AV33"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV33"
FT                   /protein_id="ABV09800.1"
FT                   DSGLTTHSSPGEMRQGN"
FT   gene            354961..355860
FT                   /locus_tag="SGO_0325"
FT   CDS             354961..355860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0325"
FT                   /product="probable membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09212"
FT                   /db_xref="GOA:A8AV34"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV34"
FT                   /protein_id="ABV09212.1"
FT                   GSIYISKANRERLAFWQS"
FT   gene            355870..357699
FT                   /locus_tag="SGO_0326"
FT   CDS             355870..357699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0326"
FT                   /product="probable membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11163"
FT                   /db_xref="GOA:A8AV35"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR018695"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV35"
FT                   /protein_id="ABV11163.1"
FT   gene            357720..359120
FT                   /locus_tag="SGO_0327"
FT   CDS             357720..359120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0327"
FT                   /product="Lipopolysaccharide
FT                   N-acetylglucosaminyltransferase"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10620"
FT                   /db_xref="GOA:A8AV36"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR022622"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV36"
FT                   /protein_id="ABV10620.1"
FT                   QMYKEYVK"
FT   gene            359120..360565
FT                   /locus_tag="SGO_0328"
FT   CDS             359120..360565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0328"
FT                   /product="transmembrane protein, putative"
FT                   /note="putative ortholog of TM1408"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09568"
FT                   /db_xref="GOA:A8AV37"
FT                   /db_xref="InterPro:IPR031617"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV37"
FT                   /protein_id="ABV09568.1"
FT   gene            360558..362333
FT                   /locus_tag="SGO_0329"
FT   CDS             360558..362333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0329"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11058"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014867"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV38"
FT                   /protein_id="ABV11058.1"
FT                   VMEDGGIKVDTYENR"
FT   gene            362296..363054
FT                   /locus_tag="SGO_0330"
FT   CDS             362296..363054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0330"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10489"
FT                   /db_xref="InterPro:IPR018966"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV39"
FT                   /protein_id="ABV10489.1"
FT   gene            363073..363744
FT                   /locus_tag="SGO_0331"
FT   CDS             363073..363744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0331"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10303"
FT                   /db_xref="GOA:A8AV40"
FT                   /db_xref="InterPro:IPR032531"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV40"
FT                   /protein_id="ABV10303.1"
FT                   G"
FT   gene            363761..365146
FT                   /locus_tag="SGO_0332"
FT   CDS             363761..365146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0332"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09986"
FT                   /db_xref="GOA:A8AV41"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032267"
FT                   /db_xref="InterPro:IPR032379"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV41"
FT                   /protein_id="ABV09986.1"
FT                   TDE"
FT   gene            365374..365643
FT                   /gene="rpsO"
FT                   /locus_tag="SGO_0333"
FT   CDS             365374..365643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsO"
FT                   /locus_tag="SGO_0333"
FT                   /product="ribosomal protein S15"
FT                   /note="identified by match to protein family HMM PF00312;
FT                   match to protein family HMM TIGR00952"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09632"
FT                   /db_xref="GOA:A8AV42"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AV42"
FT                   /protein_id="ABV09632.1"
FT   gene            complement(366257..367183)
FT                   /locus_tag="SGO_0334"
FT   CDS             complement(366257..367183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0334"
FT                   /product="cinnamoyl ester hydrolase, putative"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09510"
FT                   /db_xref="GOA:A8AV43"
FT                   /db_xref="InterPro:IPR013595"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV43"
FT                   /protein_id="ABV09510.1"
FT   gene            367472..367885
FT                   /locus_tag="SGO_0335"
FT   CDS             367472..367885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0335"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10044"
FT                   /db_xref="InterPro:IPR016787"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV44"
FT                   /protein_id="ABV10044.1"
FT   gene            368075..368296
FT                   /locus_tag="SGO_0336"
FT   CDS             368075..368296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0336"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10450"
FT                   /db_xref="InterPro:IPR027879"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV45"
FT                   /protein_id="ABV10450.1"
FT   gene            368312..368626
FT                   /gene="trx-2"
FT                   /locus_tag="SGO_0337"
FT   CDS             368312..368626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trx-2"
FT                   /locus_tag="SGO_0337"
FT                   /product="thioredoxin"
FT                   /note="identified by match to protein family HMM PF00085;
FT                   match to protein family HMM TIGR01068"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09336"
FT                   /db_xref="GOA:A8AV46"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV46"
FT                   /protein_id="ABV09336.1"
FT                   "
FT   gene            complement(368726..369394)
FT                   /locus_tag="SGO_0338"
FT   CDS             complement(368726..369394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0338"
FT                   /product="aquaporin Z, water channel protein"
FT                   /note="identified by match to protein family HMM PF00230"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09343"
FT                   /db_xref="GOA:A8AV47"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="InterPro:IPR034294"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV47"
FT                   /protein_id="ABV09343.1"
FT                   "
FT   gene            complement(369505..370296)
FT                   /locus_tag="SGO_0339"
FT   CDS             complement(369505..370296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0339"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09806"
FT                   /db_xref="InterPro:IPR021247"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV48"
FT                   /protein_id="ABV09806.1"
FT   gene            370590..371180
FT                   /locus_tag="SGO_0340"
FT   CDS             370590..371180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0340"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07366"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10301"
FT                   /db_xref="GOA:A8AV49"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV49"
FT                   /protein_id="ABV10301.1"
FT   gene            complement(371472..372116)
FT                   /locus_tag="SGO_0341"
FT   CDS             complement(371472..372116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0341"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10998"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV50"
FT                   /protein_id="ABV10998.1"
FT   gene            complement(372282..374078)
FT                   /gene="pepF-2"
FT                   /locus_tag="SGO_0342"
FT   CDS             complement(372282..374078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepF-2"
FT                   /locus_tag="SGO_0342"
FT                   /product="oligoendopeptidase"
FT                   /EC_number="3.4.-.-"
FT                   /note="identified by match to protein family HMM PF01432;
FT                   match to protein family HMM PF08439; match to protein
FT                   family HMM TIGR00181"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10275"
FT                   /db_xref="GOA:A8AV51"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR004438"
FT                   /db_xref="InterPro:IPR013647"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV51"
FT                   /protein_id="ABV10275.1"
FT   gene            complement(374193..375554)
FT                   /locus_tag="SGO_0343"
FT   CDS             complement(374193..375554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0343"
FT                   /product="transporter, major facilitator family"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09469"
FT                   /db_xref="GOA:A8AV52"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV52"
FT                   /protein_id="ABV09469.1"
FT   gene            376196..378382
FT                   /gene="pnpA"
FT                   /locus_tag="SGO_0344"
FT   CDS             376196..378382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pnpA"
FT                   /locus_tag="SGO_0344"
FT                   /product="polyribonucleotide nucleotidyltransferase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00013;
FT                   match to protein family HMM PF00575; match to protein
FT                   family HMM PF01138; match to protein family HMM PF03725;
FT                   match to protein family HMM PF03726"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10418"
FT                   /db_xref="GOA:A8AV53"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036456"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AV53"
FT                   /protein_id="ABV10418.1"
FT   gene            378469..379086
FT                   /gene="cysE"
FT                   /locus_tag="SGO_0345"
FT   CDS             378469..379086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysE"
FT                   /locus_tag="SGO_0345"
FT                   /product="serine O-acetyltransferase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM TIGR01172"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10010"
FT                   /db_xref="GOA:A8AV54"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV54"
FT                   /protein_id="ABV10010.1"
FT   gene            379135..379335
FT                   /locus_tag="SGO_0346"
FT   CDS             379135..379335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0346"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11138"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV55"
FT                   /protein_id="ABV11138.1"
FT   gene            379349..380113
FT                   /locus_tag="SGO_0347"
FT   CDS             379349..380113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0347"
FT                   /product="purine nucleoside phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10584"
FT                   /db_xref="GOA:A8AV56"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV56"
FT                   /protein_id="ABV10584.1"
FT   gene            380122..380643
FT                   /locus_tag="SGO_0348"
FT   CDS             380122..380643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0348"
FT                   /product="reductase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09679"
FT                   /db_xref="GOA:A8AV57"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV57"
FT                   /protein_id="ABV09679.1"
FT                   ELVFSRKSQK"
FT   gene            380661..382004
FT                   /gene="cysS"
FT                   /locus_tag="SGO_0349"
FT   CDS             380661..382004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="SGO_0349"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01406;
FT                   match to protein family HMM PF09190; match to protein
FT                   family HMM PF09334; match to protein family HMM TIGR00435"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10165"
FT                   /db_xref="GOA:A8AV58"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV58"
FT                   /protein_id="ABV10165.1"
FT   gene            381997..382401
FT                   /locus_tag="SGO_0350"
FT   CDS             381997..382401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0350"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /note="identified by match to protein family HMM PF00636"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10774"
FT                   /db_xref="GOA:A8AV59"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR008226"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV59"
FT                   /protein_id="ABV10774.1"
FT   gene            382388..383263
FT                   /locus_tag="SGO_0351"
FT   CDS             382388..383263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0351"
FT                   /product="leucine-rich protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09531"
FT                   /db_xref="GOA:A8AV60"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV60"
FT                   /protein_id="ABV09531.1"
FT                   CYHIILKDLF"
FT   gene            383372..384502
FT                   /locus_tag="SGO_0352"
FT   CDS             383372..384502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0352"
FT                   /product="ABC transporter, ATP-binding protein SP1580"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF03459; match to protein
FT                   family HMM PF08402"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10122"
FT                   /db_xref="GOA:A8AV61"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV61"
FT                   /protein_id="ABV10122.1"
FT   gene            384885..386732
FT                   /locus_tag="SGO_0353"
FT   CDS             384885..386732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0353"
FT                   /product="transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10485"
FT                   /db_xref="GOA:A8AV62"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV62"
FT                   /protein_id="ABV10485.1"
FT   gene            complement(386800..387762)
FT                   /locus_tag="SGO_0354"
FT   CDS             complement(386800..387762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0354"
FT                   /product="membrane spanning protein"
FT                   /note="identified by match to protein family HMM PF06081"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09314"
FT                   /db_xref="GOA:A8AV63"
FT                   /db_xref="InterPro:IPR010343"
FT                   /db_xref="InterPro:IPR021062"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV63"
FT                   /protein_id="ABV09314.1"
FT   gene            387910..388641
FT                   /locus_tag="SGO_0355"
FT   CDS             387910..388641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0355"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /note="identified by match to protein family HMM PF00588;
FT                   match to protein family HMM PF08032; match to protein
FT                   family HMM TIGR00186"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09776"
FT                   /db_xref="GOA:A8AV64"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV64"
FT                   /protein_id="ABV09776.1"
FT   gene            388641..389285
FT                   /locus_tag="SGO_0356"
FT   CDS             388641..389285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0356"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10251"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV65"
FT                   /protein_id="ABV10251.1"
FT   gene            389427..390290
FT                   /gene="degV"
FT                   /locus_tag="SGO_0357"
FT   CDS             389427..390290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="degV"
FT                   /locus_tag="SGO_0357"
FT                   /product="DegV family fatty acid binding protein"
FT                   /note="identified by match to protein family HMM PF02645;
FT                   match to protein family HMM TIGR00762"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10709"
FT                   /db_xref="GOA:A8AV66"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV66"
FT                   /protein_id="ABV10709.1"
FT                   AKNDRD"
FT   gene            390486..390932
FT                   /gene="rplM"
FT                   /locus_tag="SGO_0358"
FT   CDS             390486..390932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="SGO_0358"
FT                   /product="ribosomal protein L13"
FT                   /note="identified by match to protein family HMM PF00572;
FT                   match to protein family HMM TIGR01066"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09325"
FT                   /db_xref="GOA:A8AV67"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV67"
FT                   /protein_id="ABV09325.1"
FT   gene            390952..391344
FT                   /gene="rpsI"
FT                   /locus_tag="SGO_0359"
FT   CDS             390952..391344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="SGO_0359"
FT                   /product="ribosomal protein S9"
FT                   /note="identified by match to protein family HMM PF00380"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10461"
FT                   /db_xref="GOA:A8AV68"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AV68"
FT                   /protein_id="ABV10461.1"
FT   gene            complement(391476..392630)
FT                   /locus_tag="SGO_0360"
FT   CDS             complement(391476..392630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0360"
FT                   /product="site-specific recombinase, phage integrase
FT                   family"
FT                   /note="identified by match to protein family HMM PF00589"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09148"
FT                   /db_xref="GOA:A8AV69"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR028259"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV69"
FT                   /protein_id="ABV09148.1"
FT   gene            complement(392682..393200)
FT                   /locus_tag="SGO_0361"
FT   CDS             complement(392682..393200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0361"
FT                   /product="immunity repressor protein"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09771"
FT                   /db_xref="GOA:A8AV70"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV70"
FT                   /protein_id="ABV09771.1"
FT                   IRQEDRKNR"
FT   gene            393348..393629
FT                   /locus_tag="SGO_0362"
FT   CDS             393348..393629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0362"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10339"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV71"
FT                   /protein_id="ABV10339.1"
FT   gene            393638..394477
FT                   /locus_tag="SGO_0363"
FT   CDS             393638..394477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0363"
FT                   /product="gp49 bacteriophage-like protein"
FT                   /note="identified by match to protein family HMM TIGR01714"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10893"
FT                   /db_xref="InterPro:IPR010056"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV72"
FT                   /protein_id="ABV10893.1"
FT   gene            394836..395168
FT                   /locus_tag="SGO_0364"
FT   CDS             394836..395168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0364"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09414"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV73"
FT                   /protein_id="ABV09414.1"
FT                   DVYFQK"
FT   gene            395149..395343
FT                   /locus_tag="SGO_0365"
FT   CDS             395149..395343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0365"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10052"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV74"
FT                   /protein_id="ABV10052.1"
FT   gene            396635..397249
FT                   /gene="cadD"
FT                   /locus_tag="SGO_0366"
FT   CDS             396635..397249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cadD"
FT                   /locus_tag="SGO_0366"
FT                   /product="cadmium resistance protein"
FT                   /note="identified by match to protein family HMM PF03596;
FT                   match to protein family HMM TIGR00779"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10633"
FT                   /db_xref="GOA:A8AV75"
FT                   /db_xref="InterPro:IPR004676"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV75"
FT                   /protein_id="ABV10633.1"
FT   gene            397261..397599
FT                   /gene="cadX"
FT                   /locus_tag="SGO_0367"
FT   CDS             397261..397599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cadX"
FT                   /locus_tag="SGO_0367"
FT                   /product="cadmium efflux protein, putative"
FT                   /note="identified by match to protein family HMM PF01022"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10184"
FT                   /db_xref="GOA:A8AV76"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018334"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV76"
FT                   /protein_id="ABV10184.1"
FT                   RDFFNQLG"
FT   gene            398290..400185
FT                   /gene="merA"
FT                   /locus_tag="SGO_0368"
FT   CDS             398290..400185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="merA"
FT                   /locus_tag="SGO_0368"
FT                   /product="mercury(II) reductase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF00403; match to protein
FT                   family HMM PF02852; match to protein family HMM PF07992;
FT                   match to protein family HMM TIGR02053"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10846"
FT                   /db_xref="GOA:A8AV77"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR021179"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV77"
FT                   /protein_id="ABV10846.1"
FT   gene            400345..401666
FT                   /pseudo
FT                   /locus_tag="SGO_0369"
FT                   /note="transposase, ISL3 family, authentic frameshift; this
FT                   gene contains a frame shift which is not the result of
FT                   sequencing error"
FT   gene            complement(402256..403134)
FT                   /locus_tag="SGO_0370"
FT   CDS             complement(402256..403134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0370"
FT                   /product="malolactic fermentation system transcriptional
FT                   activator"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09204"
FT                   /db_xref="GOA:A8AV78"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV78"
FT                   /protein_id="ABV09204.1"
FT                   EALFNLIKSYK"
FT   gene            complement(403260..403610)
FT                   /locus_tag="SGO_0371"
FT   CDS             complement(403260..403610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0371"
FT                   /product="putative transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10790"
FT                   /db_xref="GOA:A8AV79"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV79"
FT                   /protein_id="ABV10790.1"
FT                   ILVIFESILDNL"
FT   gene            403981..405606
FT                   /locus_tag="SGO_0372"
FT   CDS             403981..405606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0372"
FT                   /product="malate oxidoreductase"
FT                   /EC_number="1.-.-.-"
FT                   /note="identified by match to protein family HMM PF00390;
FT                   match to protein family HMM PF03949"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10389"
FT                   /db_xref="GOA:A8AV80"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV80"
FT                   /protein_id="ABV10389.1"
FT   gene            405683..406630
FT                   /locus_tag="SGO_0373"
FT   CDS             405683..406630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0373"
FT                   /product="malate permease"
FT                   /note="identified by match to protein family HMM PF03547"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09820"
FT                   /db_xref="GOA:A8AV81"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV81"
FT                   /protein_id="ABV09820.1"
FT   gene            407897..408631
FT                   /locus_tag="SGO_0374"
FT   CDS             407897..408631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0374"
FT                   /product="Response regulator of the LytR/AlgR family"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF04397"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11063"
FT                   /db_xref="GOA:A8AV82"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV82"
FT                   /protein_id="ABV11063.1"
FT   gene            408662..409981
FT                   /pseudo
FT                   /locus_tag="SGO_0375"
FT                   /note="histidine kinase; identified by match to protein
FT                   family HMM PF02518; possible frameshift"
FT   gene            410256..410936
FT                   /locus_tag="SGO_0376"
FT   CDS             410256..410936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0376"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10146"
FT                   /db_xref="GOA:A8AV83"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV83"
FT                   /protein_id="ABV10146.1"
FT                   EEHD"
FT   gene            411043..411648
FT                   /locus_tag="SGO_0377"
FT   CDS             411043..411648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0377"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09563"
FT                   /db_xref="GOA:A8AV84"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV84"
FT                   /protein_id="ABV09563.1"
FT   gene            complement(412000..412203)
FT                   /locus_tag="SGO_0378"
FT   CDS             complement(412000..412203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0378"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05532"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10100"
FT                   /db_xref="InterPro:IPR008462"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV85"
FT                   /protein_id="ABV10100.1"
FT   gene            complement(412385..413014)
FT                   /locus_tag="SGO_0379"
FT   CDS             complement(412385..413014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0379"
FT                   /product="Protein of unknown function (DUF421) family"
FT                   /note="identified by match to protein family HMM PF04239"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09611"
FT                   /db_xref="GOA:A8AV86"
FT                   /db_xref="InterPro:IPR007353"
FT                   /db_xref="InterPro:IPR023090"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV86"
FT                   /protein_id="ABV09611.1"
FT   gene            complement(413014..413466)
FT                   /locus_tag="SGO_0380"
FT   CDS             complement(413014..413466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0380"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11000"
FT                   /db_xref="GOA:A8AV87"
FT                   /db_xref="InterPro:IPR021707"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV87"
FT                   /protein_id="ABV11000.1"
FT   gene            413751..414299
FT                   /locus_tag="SGO_0381"
FT   CDS             413751..414299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0381"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10523"
FT                   /db_xref="GOA:A8AV88"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV88"
FT                   /protein_id="ABV10523.1"
FT   gene            414395..414787
FT                   /pseudo
FT                   /locus_tag="SGO_0382"
FT                   /note="Ribosomal-protein-alanine acetyltransferase,
FT                   authentic frameshift; this gene contains a frame shift
FT                   which is not the result of sequencing error"
FT   gene            415141..416391
FT                   /locus_tag="SGO_0383"
FT   CDS             415141..416391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0383"
FT                   /product="proton/sodium-glutamate symport protein"
FT                   /note="identified by match to protein family HMM PF00375"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10970"
FT                   /db_xref="GOA:A8AV89"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV89"
FT                   /protein_id="ABV10970.1"
FT                   GHVVEESKSSKLAVRYS"
FT   gene            416406..417344
FT                   /locus_tag="SGO_0384"
FT   CDS             416406..417344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0384"
FT                   /product="putative carboxylate-amine/thiol ligase"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10210"
FT                   /db_xref="GOA:A8AV90"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV90"
FT                   /protein_id="ABV10210.1"
FT   gene            417623..421849
FT                   /locus_tag="SGO_0385"
FT   CDS             417623..421849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0385"
FT                   /product="exo-beta-D-fructosidase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00251;
FT                   match to protein family HMM PF00746; match to protein
FT                   family HMM PF02368; match to protein family HMM PF07501;
FT                   match to protein family HMM PF07554; match to protein
FT                   family HMM PF08244; match to protein family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10742"
FT                   /db_xref="GOA:A8AV91"
FT                   /db_xref="InterPro:IPR001362"
FT                   /db_xref="InterPro:IPR003343"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR013148"
FT                   /db_xref="InterPro:IPR013189"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR018053"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR022263"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="InterPro:IPR025883"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV91"
FT                   /protein_id="ABV10742.1"
FT                   RKKQED"
FT   gene            complement(421998..422834)
FT                   /locus_tag="SGO_0386"
FT   CDS             complement(421998..422834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0386"
FT                   /product="Multidrug-efflux transporter 2 regulator"
FT                   /note="identified by match to protein family HMM PF00376"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10053"
FT                   /db_xref="GOA:A8AV92"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV92"
FT                   /protein_id="ABV10053.1"
FT   gene            422921..423955
FT                   /locus_tag="SGO_0387"
FT   CDS             422921..423955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0387"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01113"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09704"
FT                   /db_xref="GOA:A8AV93"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV93"
FT                   /protein_id="ABV09704.1"
FT                   YVEK"
FT   gene            complement(424014..427271)
FT                   /locus_tag="SGO_0388"
FT   CDS             complement(424014..427271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0388"
FT                   /product="LPXTG cell wall surface protein, zinc
FT                   carboxypeptidase family"
FT                   /note="identified by match to protein family HMM PF00746;
FT                   match to protein family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10650"
FT                   /db_xref="GOA:A8AV94"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV94"
FT                   /protein_id="ABV10650.1"
FT   gene            427586..427852
FT                   /locus_tag="SGO_0389"
FT   CDS             427586..427852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0389"
FT                   /product="possible phosphoserine phosphatase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01842"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11106"
FT                   /db_xref="GOA:A8AV95"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR022986"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV95"
FT                   /protein_id="ABV11106.1"
FT   gene            427863..429200
FT                   /locus_tag="SGO_0390"
FT   CDS             427863..429200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0390"
FT                   /product="glycerol-3-phosphate dehydrogenase (NAD(P)+)"
FT                   /note="identified by match to protein family HMM PF05167"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09493"
FT                   /db_xref="InterPro:IPR007841"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AV96"
FT                   /protein_id="ABV09493.1"
FT   gene            429295..429945
FT                   /locus_tag="SGO_0391"
FT   CDS             429295..429945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0391"
FT                   /product="phosphoglycerate mutase"
FT                   /EC_number="5.4.2.-"
FT                   /note="identified by match to protein family HMM PF00300"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09960"
FT                   /db_xref="GOA:A8AV97"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV97"
FT                   /protein_id="ABV09960.1"
FT   gene            430010..430696
FT                   /locus_tag="SGO_0392"
FT   CDS             430010..430696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0392"
FT                   /product="phosphoglycerate mutase"
FT                   /EC_number="5.4.2.-"
FT                   /note="identified by match to protein family HMM PF00300"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09668"
FT                   /db_xref="GOA:A8AV98"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV98"
FT                   /protein_id="ABV09668.1"
FT                   GAKVME"
FT   gene            430758..431498
FT                   /locus_tag="SGO_0393"
FT   CDS             430758..431498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0393"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF02557"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10377"
FT                   /db_xref="GOA:A8AV99"
FT                   /db_xref="InterPro:IPR003709"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:A8AV99"
FT                   /protein_id="ABV10377.1"
FT   gene            431617..432201
FT                   /locus_tag="SGO_0394"
FT   CDS             431617..432201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0394"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11150"
FT                   /db_xref="GOA:A8AVA0"
FT                   /db_xref="InterPro:IPR024257"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVA0"
FT                   /protein_id="ABV11150.1"
FT   gene            432198..432413
FT                   /locus_tag="SGO_0395"
FT   CDS             432198..432413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0395"
FT                   /product="transcriptional regulator, Cro/CI family"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11007"
FT                   /db_xref="GOA:A8AVA1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVA1"
FT                   /protein_id="ABV11007.1"
FT   gene            432516..432839
FT                   /locus_tag="SGO_0396"
FT   CDS             432516..432839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0396"
FT                   /product="Transcriptional regulator, PadR family"
FT                   /note="identified by match to protein family HMM PF01047;
FT                   match to protein family HMM PF03551"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09356"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVA2"
FT                   /protein_id="ABV09356.1"
FT                   EDV"
FT   gene            432839..433411
FT                   /locus_tag="SGO_0397"
FT   CDS             432839..433411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0397"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11052"
FT                   /db_xref="GOA:A8AVA3"
FT                   /db_xref="InterPro:IPR021359"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVA3"
FT                   /protein_id="ABV11052.1"
FT   gene            433435..434292
FT                   /locus_tag="SGO_0398"
FT   CDS             433435..434292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0398"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09260"
FT                   /db_xref="GOA:A8AVA4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVA4"
FT                   /protein_id="ABV09260.1"
FT                   TLNV"
FT   gene            434285..435013
FT                   /locus_tag="SGO_0399"
FT   CDS             434285..435013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0399"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10159"
FT                   /db_xref="GOA:A8AVA5"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVA5"
FT                   /protein_id="ABV10159.1"
FT   gene            435177..436211
FT                   /gene="hrcA"
FT                   /locus_tag="SGO_0400"
FT   CDS             435177..436211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrcA"
FT                   /locus_tag="SGO_0400"
FT                   /product="heat-inducible transcription repressor HrcA"
FT                   /note="identified by match to protein family HMM PF01628;
FT                   match to protein family HMM TIGR00331"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10453"
FT                   /db_xref="GOA:A8AVA6"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR005104"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="InterPro:IPR023120"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AVA6"
FT                   /protein_id="ABV10453.1"
FT                   YEVH"
FT   gene            436247..436780
FT                   /gene="grpE"
FT                   /locus_tag="SGO_0401"
FT   CDS             436247..436780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grpE"
FT                   /locus_tag="SGO_0401"
FT                   /product="co-chaperone GrpE"
FT                   /note="identified by match to protein family HMM PF01025"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10272"
FT                   /db_xref="GOA:A8AVA7"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AVA7"
FT                   /protein_id="ABV10272.1"
FT                   HDRILRPAMVVVYN"
FT   gene            437031..438854
FT                   /gene="dnaK"
FT                   /locus_tag="SGO_0402"
FT   CDS             437031..438854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="SGO_0402"
FT                   /product="DnaK chaperone protein"
FT                   /note="identified by match to protein family HMM PF00012;
FT                   match to protein family HMM TIGR02350"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10760"
FT                   /db_xref="GOA:A8AVA8"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AVA8"
FT                   /protein_id="ABV10760.1"
FT   gene            439070..439702
FT                   /gene="thiJ-2"
FT                   /locus_tag="SGO_0403"
FT   CDS             439070..439702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiJ-2"
FT                   /locus_tag="SGO_0403"
FT                   /product="4-methyl-5(beta-hydroxyethyl)-thiazole
FT                   monophosphate synthesis protein"
FT                   /note="identified by match to protein family HMM PF01965"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09364"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVA9"
FT                   /protein_id="ABV09364.1"
FT   gene            439999..441144
FT                   /gene="dnaJ"
FT                   /locus_tag="SGO_0404"
FT   CDS             439999..441144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="SGO_0404"
FT                   /product="DnaJ chaparone protein"
FT                   /note="identified by match to protein family HMM PF00226;
FT                   match to protein family HMM PF00684; match to protein
FT                   family HMM PF01556; match to protein family HMM TIGR02349"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09817"
FT                   /db_xref="GOA:A8AVB0"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVB0"
FT                   /protein_id="ABV09817.1"
FT   gene            441373..444945
FT                   /locus_tag="SGO_0405"
FT   CDS             441373..444945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0405"
FT                   /product="Beta-N-acetylhexosaminidase precursor"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00728;
FT                   match to protein family HMM PF00746; match to protein
FT                   family HMM PF04650; match to protein family HMM PF07501;
FT                   match to protein family HMM TIGR01167; match to protein
FT                   family HMM TIGR01168"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10383"
FT                   /db_xref="GOA:A8AVB1"
FT                   /db_xref="InterPro:IPR005877"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR015883"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVB1"
FT                   /protein_id="ABV10383.1"
FT   gene            complement(445106..445579)
FT                   /locus_tag="SGO_0406"
FT   CDS             complement(445106..445579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0406"
FT                   /product="MutT/nudix family protein"
FT                   /note="identified by match to protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09653"
FT                   /db_xref="GOA:A8AVB2"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVB2"
FT                   /protein_id="ABV09653.1"
FT   gene            445679..446428
FT                   /gene="truA"
FT                   /locus_tag="SGO_0407"
FT   CDS             445679..446428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truA"
FT                   /locus_tag="SGO_0407"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /note="identified by match to protein family HMM PF01416;
FT                   match to protein family HMM TIGR00071"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10196"
FT                   /db_xref="GOA:A8AVB3"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AVB3"
FT                   /protein_id="ABV10196.1"
FT   gene            446803..452745
FT                   /gene="zmpB"
FT                   /locus_tag="SGO_0408"
FT   CDS             446803..452745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zmpB"
FT                   /locus_tag="SGO_0408"
FT                   /product="zinc metalloproteinase B"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00746;
FT                   match to protein family HMM PF04650; match to protein
FT                   family HMM PF07501; match to protein family HMM PF07580;
FT                   match to protein family HMM TIGR01167; match to protein
FT                   family HMM TIGR01168"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09866"
FT                   /db_xref="GOA:A8AVB4"
FT                   /db_xref="InterPro:IPR005877"
FT                   /db_xref="InterPro:IPR008006"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR011505"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVB4"
FT                   /protein_id="ABV09866.1"
FT   gene            453129..453890
FT                   /locus_tag="SGO_0409"
FT   CDS             453129..453890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0409"
FT                   /product="pyridoxine kinase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF08543"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09285"
FT                   /db_xref="GOA:A8AVB5"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVB5"
FT                   /protein_id="ABV09285.1"
FT   gene            453880..454362
FT                   /locus_tag="SGO_0410"
FT   CDS             453880..454362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0410"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11037"
FT                   /db_xref="GOA:A8AVB6"
FT                   /db_xref="InterPro:IPR009825"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVB6"
FT                   /protein_id="ABV11037.1"
FT   gene            454375..454938
FT                   /locus_tag="SGO_0411"
FT   CDS             454375..454938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0411"
FT                   /product="conserved hypothetical protein TIGR01440"
FT                   /note="identified by match to protein family HMM PF04260;
FT                   match to protein family HMM TIGR01440"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10451"
FT                   /db_xref="InterPro:IPR006340"
FT                   /db_xref="InterPro:IPR028345"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AVB7"
FT                   /protein_id="ABV10451.1"
FT   gene            455027..456310
FT                   /gene="tig"
FT                   /locus_tag="SGO_0412"
FT   CDS             455027..456310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tig"
FT                   /locus_tag="SGO_0412"
FT                   /product="trigger factor"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00254;
FT                   match to protein family HMM PF05697; match to protein
FT                   family HMM PF05698; match to protein family HMM TIGR00115"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10116"
FT                   /db_xref="GOA:A8AVB8"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AVB8"
FT                   /protein_id="ABV10116.1"
FT   gene            456471..457058
FT                   /locus_tag="SGO_0413"
FT   CDS             456471..457058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0413"
FT                   /product="DNA-directed RNA polymerase delta chain"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF05066"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10698"
FT                   /db_xref="GOA:A8AVB9"
FT                   /db_xref="InterPro:IPR007759"
FT                   /db_xref="InterPro:IPR029757"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AVB9"
FT                   /protein_id="ABV10698.1"
FT   gene            457209..457895
FT                   /locus_tag="SGO_0414"
FT   CDS             457209..457895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0414"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10233"
FT                   /db_xref="GOA:A8AVC0"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVC0"
FT                   /protein_id="ABV10233.1"
FT                   IKQSED"
FT   gene            458246..460762
FT                   /gene="secA"
FT                   /locus_tag="SGO_0415"
FT   CDS             458246..460762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /locus_tag="SGO_0415"
FT                   /product="preprotein translocase, SecA subunit"
FT                   /note="identified by match to protein family HMM PF00271;
FT                   match to protein family HMM PF01043; match to protein
FT                   family HMM PF02810; match to protein family HMM PF07516;
FT                   match to protein family HMM PF07517; match to protein
FT                   family HMM TIGR00963"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11046"
FT                   /db_xref="GOA:A8AVC1"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AVC1"
FT                   /protein_id="ABV11046.1"
FT   gene            460785..461816
FT                   /locus_tag="SGO_0416"
FT   CDS             460785..461816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0416"
FT                   /product="phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00793;
FT                   match to protein family HMM TIGR00034"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10433"
FT                   /db_xref="GOA:A8AVC2"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVC2"
FT                   /protein_id="ABV10433.1"
FT                   LEK"
FT   gene            461860..462294
FT                   /gene="acpS"
FT                   /locus_tag="SGO_0417"
FT   CDS             461860..462294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpS"
FT                   /locus_tag="SGO_0417"
FT                   /product="holo-(acyl-carrier-protein) synthase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01648;
FT                   match to protein family HMM TIGR00516; match to protein
FT                   family HMM TIGR00556"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11152"
FT                   /db_xref="GOA:A8AVC3"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVC3"
FT                   /protein_id="ABV11152.1"
FT   gene            462284..463390
FT                   /gene="alr"
FT                   /locus_tag="SGO_0418"
FT   CDS             462284..463390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alr"
FT                   /locus_tag="SGO_0418"
FT                   /product="alanine racemase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00842;
FT                   match to protein family HMM PF01168; match to protein
FT                   family HMM TIGR00492"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09604"
FT                   /db_xref="GOA:A8AVC4"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AVC4"
FT                   /protein_id="ABV09604.1"
FT   gene            463463..465478
FT                   /gene="recG"
FT                   /locus_tag="SGO_0419"
FT   CDS             463463..465478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recG"
FT                   /locus_tag="SGO_0419"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271; match to protein
FT                   family HMM PF04851; match to protein family HMM TIGR00643"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10175"
FT                   /db_xref="GOA:A8AVC5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVC5"
FT                   /protein_id="ABV10175.1"
FT   gene            465516..465638
FT                   /locus_tag="SGO_0420"
FT   CDS             465516..465638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0420"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10176"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVC6"
FT                   /protein_id="ABV10176.1"
FT   gene            465900..467942
FT                   /locus_tag="SGO_0421"
FT   CDS             465900..467942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0421"
FT                   /product="Phosphotransferase system
FT                   mannitol/fructose-specific IIA domain, putative"
FT                   /note="identified by match to protein family HMM PF00359;
FT                   match to protein family HMM PF00874; match to protein
FT                   family HMM PF05043; match to protein family HMM PF08279"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10862"
FT                   /db_xref="GOA:A8AVC7"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVC7"
FT                   /protein_id="ABV10862.1"
FT   gene            467935..468216
FT                   /locus_tag="SGO_0422"
FT   CDS             467935..468216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0422"
FT                   /product="PTS system, Lactose specific IIB subunit
FT                   subfamily"
FT                   /note="identified by match to protein family HMM PF02302"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09379"
FT                   /db_xref="GOA:A8AVC8"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVC8"
FT                   /protein_id="ABV09379.1"
FT   gene            468242..469528
FT                   /locus_tag="SGO_0423"
FT   CDS             468242..469528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0423"
FT                   /product="Putative sugar-specific permease"
FT                   /note="identified by match to protein family HMM PF04215"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09811"
FT                   /db_xref="GOA:A8AVC9"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVC9"
FT                   /protein_id="ABV09811.1"
FT   gene            469528..470214
FT                   /gene="trpA-1"
FT                   /locus_tag="SGO_0424"
FT   CDS             469528..470214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpA-1"
FT                   /locus_tag="SGO_0424"
FT                   /product="tryptophan synthase, alpha subunit"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00290;
FT                   match to protein family HMM TIGR00262"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09360"
FT                   /db_xref="GOA:A8AVD0"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVD0"
FT                   /protein_id="ABV09360.1"
FT                   YLQSFQ"
FT   gene            complement(470394..471356)
FT                   /gene="ansB"
FT                   /locus_tag="SGO_0425"
FT   CDS             complement(470394..471356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ansB"
FT                   /locus_tag="SGO_0425"
FT                   /product="asparaginase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00710"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09689"
FT                   /db_xref="GOA:A8AVD1"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR020827"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR027475"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVD1"
FT                   /protein_id="ABV09689.1"
FT   gene            471420..472811
FT                   /locus_tag="SGO_0426"
FT   CDS             471420..472811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0426"
FT                   /product="Cof family protein"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM PF05116; match to protein
FT                   family HMM PF08282; match to protein family HMM TIGR00099;
FT                   match to protein family HMM TIGR01484"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09618"
FT                   /db_xref="GOA:A8AVD2"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023292"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVD2"
FT                   /protein_id="ABV09618.1"
FT                   SKEKN"
FT   gene            complement(472849..473301)
FT                   /locus_tag="SGO_0427"
FT   CDS             complement(472849..473301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0427"
FT                   /product="universal stress protein family"
FT                   /note="identified by match to protein family HMM PF00582"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09947"
FT                   /db_xref="GOA:A8AVD3"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVD3"
FT                   /protein_id="ABV09947.1"
FT   gene            473531..473653
FT                   /locus_tag="SGO_0428"
FT   CDS             473531..473653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0428"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09762"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVD4"
FT                   /protein_id="ABV09762.1"
FT   gene            473692..474906
FT                   /locus_tag="SGO_0429"
FT   CDS             473692..474906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0429"
FT                   /product="aspartate transaminase"
FT                   /note="identified by match to protein family HMM PF00155"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11105"
FT                   /db_xref="GOA:A8AVD5"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVD5"
FT                   /protein_id="ABV11105.1"
FT                   QQYRR"
FT   gene            475283..477943
FT                   /locus_tag="SGO_0430"
FT   CDS             475283..477943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0430"
FT                   /product="LPXTG cell wall surface protein"
FT                   /note="identified by match to protein family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10931"
FT                   /db_xref="GOA:A8AVD6"
FT                   /db_xref="InterPro:IPR027607"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVD6"
FT                   /protein_id="ABV10931.1"
FT                   GFALLIWKHKKESKN"
FT   gene            478229..479017
FT                   /locus_tag="SGO_0431"
FT   CDS             478229..479017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0431"
FT                   /product="GTP-sensing transcriptional pleiotropic repressor
FT                   codY"
FT                   /note="identified by match to protein family HMM PF06018;
FT                   match to protein family HMM PF08222; match to protein
FT                   family HMM PF08279; match to protein family HMM TIGR02787"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09190"
FT                   /db_xref="GOA:A8AVD7"
FT                   /db_xref="InterPro:IPR010312"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013198"
FT                   /db_xref="InterPro:IPR014154"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AVD7"
FT                   /protein_id="ABV09190.1"
FT   gene            479017..479574
FT                   /gene="entB"
FT                   /locus_tag="SGO_0432"
FT   CDS             479017..479574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="entB"
FT                   /locus_tag="SGO_0432"
FT                   /product="isochorismatase family protein"
FT                   /note="identified by match to protein family HMM PF00857"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09992"
FT                   /db_xref="GOA:A8AVD8"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVD8"
FT                   /protein_id="ABV09992.1"
FT   gene            complement(479571..479696)
FT                   /locus_tag="SGO_0433"
FT   CDS             complement(479571..479696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0433"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10346"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVD9"
FT                   /protein_id="ABV10346.1"
FT   gene            479974..481710
FT                   /gene="aspS-2"
FT                   /locus_tag="SGO_0434"
FT   CDS             479974..481710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspS-2"
FT                   /locus_tag="SGO_0434"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00152;
FT                   match to protein family HMM PF00587; match to protein
FT                   family HMM PF01336; match to protein family HMM PF02938;
FT                   match to protein family HMM TIGR00459"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10832"
FT                   /db_xref="GOA:A8AVE0"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVE0"
FT                   /protein_id="ABV10832.1"
FT                   KK"
FT   gene            481914..482216
FT                   /gene="gatC"
FT                   /locus_tag="SGO_0435"
FT   CDS             481914..482216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatC"
FT                   /locus_tag="SGO_0435"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, C subunit"
FT                   /EC_number="6.3.5.-"
FT                   /note="identified by match to protein family HMM PF02686;
FT                   match to protein family HMM TIGR00135"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09236"
FT                   /db_xref="GOA:A8AVE1"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AVE1"
FT                   /protein_id="ABV09236.1"
FT   gene            482216..483682
FT                   /gene="gatA"
FT                   /locus_tag="SGO_0436"
FT   CDS             482216..483682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatA"
FT                   /locus_tag="SGO_0436"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, A subunit"
FT                   /EC_number="6.3.5.-"
FT                   /note="identified by match to protein family HMM PF01425;
FT                   match to protein family HMM TIGR00132"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09369"
FT                   /db_xref="GOA:A8AVE2"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AVE2"
FT                   /protein_id="ABV09369.1"
FT   gene            483682..485115
FT                   /gene="gatB"
FT                   /locus_tag="SGO_0437"
FT   CDS             483682..485115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatB"
FT                   /locus_tag="SGO_0437"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, B subunit"
FT                   /EC_number="6.3.5.-"
FT                   /note="identified by match to protein family HMM PF01162;
FT                   match to protein family HMM PF02637; match to protein
FT                   family HMM PF02934; match to protein family HMM TIGR00133"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10473"
FT                   /db_xref="GOA:A8AVE3"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AVE3"
FT                   /protein_id="ABV10473.1"
FT   gene            485184..485984
FT                   /locus_tag="SGO_0438"
FT   CDS             485184..485984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0438"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11049"
FT                   /db_xref="GOA:A8AVE4"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVE4"
FT                   /protein_id="ABV11049.1"
FT   gene            486077..486370
FT                   /locus_tag="SGO_0439"
FT   CDS             486077..486370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0439"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09554"
FT                   /db_xref="GOA:A8AVE5"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVE5"
FT                   /protein_id="ABV09554.1"
FT   gene            486602..487648
FT                   /locus_tag="SGO_0440"
FT   CDS             486602..487648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0440"
FT                   /product="L-iditol 2-dehydrogenase BH3949"
FT                   /EC_number="1.1.1.-"
FT                   /note="identified by match to protein family HMM PF00107;
FT                   match to protein family HMM PF08240"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09535"
FT                   /db_xref="GOA:A8AVE6"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVE6"
FT                   /protein_id="ABV09535.1"
FT                   IKILVSPE"
FT   gene            487747..488658
FT                   /locus_tag="SGO_0441"
FT   CDS             487747..488658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0441"
FT                   /product="membrane protein"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10131"
FT                   /db_xref="GOA:A8AVE7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVE7"
FT                   /protein_id="ABV10131.1"
FT   gene            complement(488718..489344)
FT                   /locus_tag="SGO_0442"
FT   CDS             complement(488718..489344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0442"
FT                   /product="immunoreactive protein Se23.5-like protein"
FT                   /note="identified by match to protein family HMM PF09335"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10261"
FT                   /db_xref="GOA:A8AVE8"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVE8"
FT                   /protein_id="ABV10261.1"
FT   gene            489713..490195
FT                   /locus_tag="SGO_0443"
FT   CDS             489713..490195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0443"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10849"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVE9"
FT                   /protein_id="ABV10849.1"
FT   gene            490406..490915
FT                   /locus_tag="SGO_0444"
FT   CDS             490406..490915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0444"
FT                   /product="HAD superfamily (subfamily IIIA) phosphatase,
FT                   TIGR01668"
FT                   /EC_number="3.1.3.-"
FT                   /note="identified by match to protein family HMM TIGR01549;
FT                   match to protein family HMM TIGR01662; match to protein
FT                   family HMM TIGR01668"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09273"
FT                   /db_xref="GOA:A8AVF0"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR010021"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVF0"
FT                   /protein_id="ABV09273.1"
FT                   QYKKGI"
FT   gene            490918..492024
FT                   /locus_tag="SGO_0445"
FT   CDS             490918..492024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0445"
FT                   /product="GTP-binding protein"
FT                   /note="identified by match to protein family HMM PF01926"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09266"
FT                   /db_xref="GOA:A8AVF1"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019988"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVF1"
FT                   /protein_id="ABV09266.1"
FT   gene            492132..492443
FT                   /locus_tag="SGO_0446"
FT   CDS             492132..492443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0446"
FT                   /product="conserved hypothetical protein TIGR00253"
FT                   /note="identified by match to protein family HMM PF01985;
FT                   match to protein family HMM TIGR00253"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09859"
FT                   /db_xref="GOA:A8AVF2"
FT                   /db_xref="InterPro:IPR001890"
FT                   /db_xref="InterPro:IPR017924"
FT                   /db_xref="InterPro:IPR035920"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVF2"
FT                   /protein_id="ABV09859.1"
FT   gene            492472..493104
FT                   /gene="nadD"
FT                   /locus_tag="SGO_0447"
FT   CDS             492472..493104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadD"
FT                   /locus_tag="SGO_0447"
FT                   /product="nicotinate (nicotinamide) nucleotide
FT                   adenylyltransferase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01467;
FT                   match to protein family HMM TIGR00125; match to protein
FT                   family HMM TIGR00482"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10467"
FT                   /db_xref="GOA:A8AVF3"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVF3"
FT                   /protein_id="ABV10467.1"
FT   gene            493101..493700
FT                   /locus_tag="SGO_0448"
FT   CDS             493101..493700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0448"
FT                   /product="conserved hypothetical protein TIGR00488"
FT                   /note="identified by match to protein family HMM PF01966;
FT                   match to protein family HMM TIGR00488"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11165"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR005249"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVF4"
FT                   /protein_id="ABV11165.1"
FT   gene            493697..494200
FT                   /locus_tag="SGO_0449"
FT   CDS             493697..494200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0449"
FT                   /product="isochorismatase family protein"
FT                   /note="identified by match to protein family HMM PF00857"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10073"
FT                   /db_xref="GOA:A8AVF5"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVF5"
FT                   /protein_id="ABV10073.1"
FT                   NIFN"
FT   gene            494210..494575
FT                   /locus_tag="SGO_0450"
FT   CDS             494210..494575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0450"
FT                   /product="iojap-related protein"
FT                   /note="identified by match to protein family HMM PF02410;
FT                   match to protein family HMM TIGR00090"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09707"
FT                   /db_xref="GOA:A8AVF6"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVF6"
FT                   /protein_id="ABV09707.1"
FT                   HEATGVDVAALLEEKNK"
FT   gene            494651..495385
FT                   /locus_tag="SGO_0451"
FT   CDS             494651..495385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0451"
FT                   /product="methyltransferase"
FT                   /note="identified by match to protein family HMM PF08241;
FT                   match to protein family HMM PF08242"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10211"
FT                   /db_xref="GOA:A8AVF7"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVF7"
FT                   /protein_id="ABV10211.1"
FT   gene            495387..496478
FT                   /locus_tag="SGO_0452"
FT   CDS             495387..496478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0452"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05636"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10943"
FT                   /db_xref="InterPro:IPR008513"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AVF8"
FT                   /protein_id="ABV10943.1"
FT   gene            496549..497379
FT                   /locus_tag="SGO_0453"
FT   CDS             496549..497379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0453"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10974"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVF9"
FT                   /protein_id="ABV10974.1"
FT   gene            497609..498325
FT                   /locus_tag="SGO_0454"
FT   CDS             497609..498325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0454"
FT                   /product="conserved hypothetical protein TIGR01033"
FT                   /note="identified by match to protein family HMM PF01709;
FT                   match to protein family HMM TIGR01033"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10904"
FT                   /db_xref="GOA:A8AVG0"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026562"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AVG0"
FT                   /protein_id="ABV10904.1"
FT                   EDDEDVQKVYTNVEGF"
FT   gene            498446..499555
FT                   /locus_tag="SGO_0455"
FT   CDS             498446..499555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0455"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10547"
FT                   /db_xref="InterPro:IPR029050"
FT                   /db_xref="InterPro:IPR029051"
FT                   /db_xref="InterPro:IPR031343"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVG1"
FT                   /protein_id="ABV10547.1"
FT   gene            499666..500799
FT                   /gene="ILL5"
FT                   /locus_tag="SGO_0456"
FT   CDS             499666..500799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ILL5"
FT                   /locus_tag="SGO_0456"
FT                   /product="amino acid aminohydrolase"
FT                   /note="identified by match to protein family HMM PF01546;
FT                   match to protein family HMM PF07687; match to protein
FT                   family HMM TIGR01891"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10112"
FT                   /db_xref="GOA:A8AVG2"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR033846"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVG2"
FT                   /protein_id="ABV10112.1"
FT   gene            500988..501845
FT                   /locus_tag="SGO_0457"
FT   CDS             500988..501845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0457"
FT                   /product="ABC transporter, substrate-binding protein
FT                   SP0148"
FT                   /note="identified by match to protein family HMM PF00497"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09131"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVG3"
FT                   /protein_id="ABV09131.1"
FT                   KDIK"
FT   gene            501879..502742
FT                   /gene="hlpA"
FT                   /locus_tag="SGO_0458"
FT   CDS             501879..502742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hlpA"
FT                   /locus_tag="SGO_0458"
FT                   /product="lipoprotein"
FT                   /note="identified by match to protein family HMM PF03180"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11133"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVG4"
FT                   /protein_id="ABV11133.1"
FT                   LLEPVW"
FT   gene            502866..504239
FT                   /locus_tag="SGO_0459"
FT   CDS             502866..504239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0459"
FT                   /product="succinyl-diaminopimelate desuccinylase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01546;
FT                   match to protein family HMM PF07687"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09754"
FT                   /db_xref="GOA:A8AVG5"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVG5"
FT                   /protein_id="ABV09754.1"
FT   gene            504232..505296
FT                   /locus_tag="SGO_0460"
FT   CDS             504232..505296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0460"
FT                   /product="ABC transporter, ATP-binding protein SP0151"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09983"
FT                   /db_xref="GOA:A8AVG6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVG6"
FT                   /protein_id="ABV09983.1"
FT                   SEAGVRLTVLKGGA"
FT   gene            505298..505990
FT                   /locus_tag="SGO_0461"
FT   CDS             505298..505990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0461"
FT                   /product="ABC transporter, permease protein, putative"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09395"
FT                   /db_xref="GOA:A8AVG7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVG7"
FT                   /protein_id="ABV09395.1"
FT                   LTKKLSHK"
FT   gene            506027..506254
FT                   /locus_tag="SGO_0462"
FT   CDS             506027..506254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0462"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10521"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVG8"
FT                   /protein_id="ABV10521.1"
FT   gene            506199..507875
FT                   /gene="cydD"
FT                   /locus_tag="SGO_0463"
FT   CDS             506199..507875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydD"
FT                   /locus_tag="SGO_0463"
FT                   /product="putative ABC transporter (ATP-binding protein)"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11072"
FT                   /db_xref="GOA:A8AVG9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVG9"
FT                   /protein_id="ABV11072.1"
FT   gene            507865..509535
FT                   /gene="cydC"
FT                   /locus_tag="SGO_0464"
FT   CDS             507865..509535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydC"
FT                   /locus_tag="SGO_0464"
FT                   /product="putative ABC transporter (ATP-binding protein)"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09230"
FT                   /db_xref="GOA:A8AVH0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVH0"
FT                   /protein_id="ABV09230.1"
FT   gene            509532..510128
FT                   /locus_tag="SGO_0465"
FT   CDS             509532..510128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0465"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM TIGR02185"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09596"
FT                   /db_xref="GOA:A8AVH1"
FT                   /db_xref="InterPro:IPR011733"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVH1"
FT                   /protein_id="ABV09596.1"
FT   gene            510125..510805
FT                   /locus_tag="SGO_0466"
FT   CDS             510125..510805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0466"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF02361"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10145"
FT                   /db_xref="GOA:A8AVH2"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVH2"
FT                   /protein_id="ABV10145.1"
FT                   MIRG"
FT   gene            510766..512193
FT                   /locus_tag="SGO_0467"
FT   CDS             510766..512193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0467"
FT                   /product="ATP binding protein of ABC transporter"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09536"
FT                   /db_xref="GOA:A8AVH3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVH3"
FT                   /protein_id="ABV09536.1"
FT                   HDEELLEKTADYFLTLN"
FT   gene            512381..513226
FT                   /locus_tag="SGO_0468"
FT   CDS             512381..513226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0468"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01887;
FT                   match to protein family HMM TIGR03304"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09293"
FT                   /db_xref="InterPro:IPR002747"
FT                   /db_xref="InterPro:IPR023227"
FT                   /db_xref="InterPro:IPR023228"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVH4"
FT                   /protein_id="ABV09293.1"
FT                   "
FT   gene            513250..513810
FT                   /locus_tag="SGO_0469"
FT   CDS             513250..513810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0469"
FT                   /product="integral membrane protein"
FT                   /note="identified by match to protein family HMM PF07155"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10468"
FT                   /db_xref="GOA:A8AVH5"
FT                   /db_xref="InterPro:IPR009825"
FT                   /db_xref="InterPro:IPR022914"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AVH5"
FT                   /protein_id="ABV10468.1"
FT   gene            513949..514116
FT                   /locus_tag="SGO_0470"
FT   CDS             513949..514116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0470"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09780"
FT                   /db_xref="GOA:A8AVH6"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVH6"
FT                   /protein_id="ABV09780.1"
FT                   LLGIATKKKK"
FT   gene            514113..514325
FT                   /locus_tag="SGO_0471"
FT   CDS             514113..514325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0471"
FT                   /product="DNA-binding protein"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10077"
FT                   /db_xref="GOA:A8AVH7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVH7"
FT                   /protein_id="ABV10077.1"
FT   gene            514608..515105
FT                   /locus_tag="SGO_0472"
FT   CDS             514608..515105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0472"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09603"
FT                   /db_xref="GOA:A8AVH8"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVH8"
FT                   /protein_id="ABV09603.1"
FT                   EN"
FT   gene            515222..515620
FT                   /locus_tag="SGO_0473"
FT   CDS             515222..515620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0473"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10900"
FT                   /db_xref="GOA:A8AVH9"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVH9"
FT                   /protein_id="ABV10900.1"
FT   gene            515617..516294
FT                   /locus_tag="SGO_0474"
FT   CDS             515617..516294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0474"
FT                   /product="abortive infection protein"
FT                   /note="identified by match to protein family HMM PF02517"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09763"
FT                   /db_xref="GOA:A8AVI0"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVI0"
FT                   /protein_id="ABV09763.1"
FT                   MEV"
FT   gene            516304..516792
FT                   /locus_tag="SGO_0475"
FT   CDS             516304..516792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0475"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09180"
FT                   /db_xref="GOA:A8AVI1"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVI1"
FT                   /protein_id="ABV09180.1"
FT   gene            516920..517906
FT                   /locus_tag="SGO_0476"
FT   CDS             516920..517906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0476"
FT                   /product="rhodanese family protein"
FT                   /note="identified by match to protein family HMM PF00581"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09400"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR020936"
FT                   /db_xref="InterPro:IPR022111"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AVI2"
FT                   /protein_id="ABV09400.1"
FT   gene            complement(518148..519092)
FT                   /locus_tag="SGO_0477"
FT   CDS             complement(518148..519092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0477"
FT                   /product="cell wall binding protein"
FT                   /note="identified by match to protein family HMM PF01473"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11146"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVI3"
FT                   /protein_id="ABV11146.1"
FT   gene            complement(519464..520405)
FT                   /locus_tag="SGO_0478"
FT   CDS             complement(519464..520405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0478"
FT                   /product="cell wall binding protein"
FT                   /note="identified by match to protein family HMM PF01473"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10360"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVI4"
FT                   /protein_id="ABV10360.1"
FT   gene            520893..521696
FT                   /locus_tag="SGO_0479"
FT   CDS             520893..521696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0479"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09678"
FT                   /db_xref="GOA:A8AVI5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVI5"
FT                   /protein_id="ABV09678.1"
FT   gene            521753..522166
FT                   /locus_tag="SGO_0480"
FT   CDS             521753..522166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0480"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06983"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11066"
FT                   /db_xref="InterPro:IPR028973"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVI6"
FT                   /protein_id="ABV11066.1"
FT   gene            522176..522535
FT                   /locus_tag="SGO_0481"
FT   CDS             522176..522535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0481"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09540"
FT                   /db_xref="InterPro:IPR007076"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVI7"
FT                   /protein_id="ABV09540.1"
FT                   LALAYNQELSQSSET"
FT   gene            522962..523582
FT                   /locus_tag="SGO_0482"
FT   CDS             522962..523582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0482"
FT                   /product="ThiJ/PfpI family protein"
FT                   /note="identified by match to protein family HMM PF01965"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09415"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVI8"
FT                   /protein_id="ABV09415.1"
FT   gene            523732..524640
FT                   /locus_tag="SGO_0483"
FT   CDS             523732..524640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0483"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09270"
FT                   /db_xref="InterPro:IPR025387"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVI9"
FT                   /protein_id="ABV09270.1"
FT   gene            complement(524793..526025)
FT                   /locus_tag="SGO_0484"
FT   CDS             complement(524793..526025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0484"
FT                   /product="sensor histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10454"
FT                   /db_xref="GOA:A8AVJ0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVJ0"
FT                   /protein_id="ABV10454.1"
FT                   KKGRITFNISL"
FT   gene            complement(526015..526701)
FT                   /locus_tag="SGO_0485"
FT   CDS             complement(526015..526701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0485"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10779"
FT                   /db_xref="GOA:A8AVJ1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVJ1"
FT                   /protein_id="ABV10779.1"
FT                   GEDHVS"
FT   gene            complement(526705..527331)
FT                   /locus_tag="SGO_0486"
FT   CDS             complement(526705..527331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0486"
FT                   /product="GTP pyrophosphokinase family protein"
FT                   /note="identified by match to protein family HMM PF04607"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09288"
FT                   /db_xref="GOA:A8AVJ2"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVJ2"
FT                   /protein_id="ABV09288.1"
FT   gene            527547..528308
FT                   /locus_tag="SGO_0487"
FT   CDS             527547..528308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0487"
FT                   /product="phosphorylase, Pnp/Udp family"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10636"
FT                   /db_xref="GOA:A8AVJ3"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVJ3"
FT                   /protein_id="ABV10636.1"
FT   gene            528319..530004
FT                   /locus_tag="SGO_0488"
FT   CDS             528319..530004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0488"
FT                   /product="ABC transporter, ATP-binding protein SP0483"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09617"
FT                   /db_xref="GOA:A8AVJ4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022216"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVJ4"
FT                   /protein_id="ABV09617.1"
FT   gene            529991..530827
FT                   /locus_tag="SGO_0489"
FT   CDS             529991..530827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0489"
FT                   /product="cobalt transport family protein"
FT                   /note="identified by match to protein family HMM PF02361"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09613"
FT                   /db_xref="GOA:A8AVJ5"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVJ5"
FT                   /protein_id="ABV09613.1"
FT   gene            530847..531707
FT                   /locus_tag="SGO_0490"
FT   CDS             530847..531707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0490"
FT                   /product="CAAX amino terminal protease family"
FT                   /note="identified by match to protein family HMM PF02517"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10979"
FT                   /db_xref="GOA:A8AVJ6"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVJ6"
FT                   /protein_id="ABV10979.1"
FT                   RNEVL"
FT   gene            complement(531784..532497)
FT                   /gene="gidB"
FT                   /locus_tag="SGO_0491"
FT   CDS             complement(531784..532497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidB"
FT                   /locus_tag="SGO_0491"
FT                   /product="methyltransferase GidB"
FT                   /note="identified by match to protein family HMM PF02527;
FT                   match to protein family HMM TIGR00138"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10542"
FT                   /db_xref="GOA:A8AVJ7"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AVJ7"
FT                   /protein_id="ABV10542.1"
FT                   NKYPRKAGMPNKRPL"
FT   gene            complement(532576..533865)
FT                   /locus_tag="SGO_0492"
FT   CDS             complement(532576..533865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0492"
FT                   /product="macrolide-efflux protein"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09297"
FT                   /db_xref="GOA:A8AVJ8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVJ8"
FT                   /protein_id="ABV09297.1"
FT   gene            complement(533878..534480)
FT                   /locus_tag="SGO_0493"
FT   CDS             complement(533878..534480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0493"
FT                   /product="transcriptional regulator, TetR family, putative"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09258"
FT                   /db_xref="GOA:A8AVJ9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVJ9"
FT                   /protein_id="ABV09258.1"
FT   gene            534696..535265
FT                   /gene="lemA"
FT                   /locus_tag="SGO_0494"
FT   CDS             534696..535265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lemA"
FT                   /locus_tag="SGO_0494"
FT                   /product="LemA-like protein"
FT                   /note="identified by match to protein family HMM PF04011"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09455"
FT                   /db_xref="GOA:A8AVK0"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AVK0"
FT                   /protein_id="ABV09455.1"
FT   gene            535267..536160
FT                   /gene="htpx"
FT                   /locus_tag="SGO_0495"
FT   CDS             535267..536160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htpx"
FT                   /locus_tag="SGO_0495"
FT                   /product="heat shock protein"
FT                   /EC_number="3.4.24.-"
FT                   /note="identified by match to protein family HMM PF01435"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10968"
FT                   /db_xref="GOA:O30795"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/Swiss-Prot:O30795"
FT                   /protein_id="ABV10968.1"
FT                   YTHPPISERVERLRKM"
FT   gene            536544..537437
FT                   /gene="rgg"
FT                   /locus_tag="SGO_0496"
FT   CDS             536544..537437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rgg"
FT                   /locus_tag="SGO_0496"
FT                   /product="transcriptional regulator Rgg"
FT                   /note="identified by match to protein family HMM PF01381;
FT                   match to protein family HMM TIGR01716"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10604"
FT                   /db_xref="GOA:P49330"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010057"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/Swiss-Prot:P49330"
FT                   /protein_id="ABV10604.1"
FT                   QFERIQLTVVADLQIE"
FT   gene            537504..542234
FT                   /gene="gtfG"
FT                   /locus_tag="SGO_0497"
FT   CDS             537504..542234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gtfG"
FT                   /locus_tag="SGO_0497"
FT                   /product="glucosyltransferase G"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01473;
FT                   match to protein family HMM PF02324"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09519"
FT                   /db_xref="GOA:A8AVK3"
FT                   /db_xref="InterPro:IPR003318"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="InterPro:IPR022263"
FT                   /db_xref="InterPro:IPR027636"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVK3"
FT                   /protein_id="ABV09519.1"
FT   gene            complement(542385..543620)
FT                   /gene="dsg"
FT                   /locus_tag="SGO_0498"
FT   CDS             complement(542385..543620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsg"
FT                   /locus_tag="SGO_0498"
FT                   /product="putative permease"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10206"
FT                   /db_xref="GOA:A8AVK4"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVK4"
FT                   /protein_id="ABV10206.1"
FT                   LLLSIKKKNEIK"
FT   gene            543638..543760
FT                   /locus_tag="SGO_0499"
FT   CDS             543638..543760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0499"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09770"
FT                   /db_xref="GOA:A8AVK5"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVK5"
FT                   /protein_id="ABV09770.1"
FT   gene            complement(543960..544829)
FT                   /gene="rggD"
FT                   /locus_tag="SGO_0500"
FT   CDS             complement(543960..544829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rggD"
FT                   /locus_tag="SGO_0500"
FT                   /product="putative transcriptional regulator RggD"
FT                   /note="identified by match to protein family HMM PF01381;
FT                   match to protein family HMM TIGR01716"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10992"
FT                   /db_xref="GOA:A8AVK6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010057"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVK6"
FT                   /protein_id="ABV10992.1"
FT                   AAFQKYSK"
FT   gene            544928..545458
FT                   /locus_tag="SGO_0501"
FT   CDS             544928..545458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0501"
FT                   /product="Uncharacterized ACR, COG1399"
FT                   /note="identified by match to protein family HMM PF02620"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10549"
FT                   /db_xref="InterPro:IPR003772"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVK7"
FT                   /protein_id="ABV10549.1"
FT                   NSPFAGLQGLFDE"
FT   gene            545561..547042
FT                   /gene="floL"
FT                   /locus_tag="SGO_0502"
FT   CDS             545561..547042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="floL"
FT                   /locus_tag="SGO_0502"
FT                   /product="flotillin-like protein"
FT                   /note="identified by match to protein family HMM PF01145;
FT                   match to protein family HMM PF03149"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10565"
FT                   /db_xref="GOA:A8AVK8"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR027705"
FT                   /db_xref="InterPro:IPR031905"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVK8"
FT                   /protein_id="ABV10565.1"
FT   gene            547178..548602
FT                   /gene="gnd"
FT                   /locus_tag="SGO_0503"
FT   CDS             547178..548602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gnd"
FT                   /locus_tag="SGO_0503"
FT                   /product="6-phosphogluconate dehydrogenase,
FT                   decarboxylating"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00393;
FT                   match to protein family HMM PF03446; match to protein
FT                   family HMM TIGR00873"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09837"
FT                   /db_xref="GOA:A8AVK9"
FT                   /db_xref="InterPro:IPR006113"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVK9"
FT                   /protein_id="ABV09837.1"
FT                   RKDKEGTFHYSWYDEK"
FT   gene            548615..549304
FT                   /locus_tag="SGO_0504"
FT   CDS             548615..549304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0504"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09384"
FT                   /db_xref="GOA:A8AVL0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVL0"
FT                   /protein_id="ABV09384.1"
FT                   IGYSMQG"
FT   gene            549664..551856
FT                   /locus_tag="SGO_0505"
FT   CDS             549664..551856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0505"
FT                   /product="PTS system, IIBC component"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00358;
FT                   match to protein family HMM PF00367; match to protein
FT                   family HMM PF02378; match to protein family HMM TIGR00826;
FT                   match to protein family HMM TIGR00830; match to protein
FT                   family HMM TIGR02003"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10750"
FT                   /db_xref="GOA:A8AVL1"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR011300"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVL1"
FT                   /protein_id="ABV10750.1"
FT   gene            551874..552689
FT                   /gene="rgfB"
FT                   /locus_tag="SGO_0506"
FT   CDS             551874..552689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rgfB"
FT                   /locus_tag="SGO_0506"
FT                   /product="RgfB"
FT                   /note="identified by match to protein family HMM PF03372"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10712"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVL2"
FT                   /protein_id="ABV10712.1"
FT   gene            complement(552832..553248)
FT                   /locus_tag="SGO_0507"
FT   CDS             complement(552832..553248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0507"
FT                   /product="protein of unknown function/lipoprotein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09833"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVL3"
FT                   /protein_id="ABV09833.1"
FT   gene            553427..553900
FT                   /gene="nrdR"
FT                   /locus_tag="SGO_0508"
FT   CDS             553427..553900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdR"
FT                   /locus_tag="SGO_0508"
FT                   /product="transcriptional regulator, NrdR family"
FT                   /note="identified by match to protein family HMM PF03477;
FT                   match to protein family HMM TIGR00244"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09767"
FT                   /db_xref="GOA:A8AVL4"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AVL4"
FT                   /protein_id="ABV09767.1"
FT   gene            553901..555055
FT                   /locus_tag="SGO_0509"
FT   CDS             553901..555055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0509"
FT                   /product="Replication initiation and membrane attachment
FT                   protein (DnaB) superfamily"
FT                   /note="identified by match to protein family HMM PF07261"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09136"
FT                   /db_xref="InterPro:IPR006343"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVL5"
FT                   /protein_id="ABV09136.1"
FT   gene            555056..555955
FT                   /gene="dnaI"
FT                   /locus_tag="SGO_0510"
FT   CDS             555056..555955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaI"
FT                   /locus_tag="SGO_0510"
FT                   /product="primosomal protein DnaI"
FT                   /note="identified by match to protein family HMM PF07319"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11178"
FT                   /db_xref="GOA:A8AVL6"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR009928"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVL6"
FT                   /protein_id="ABV11178.1"
FT                   ERIKFLAQEVRLEGENRR"
FT   gene            555952..556668
FT                   /locus_tag="SGO_0511"
FT   CDS             555952..556668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0511"
FT                   /product="NADPH-flavin oxidoreductase-like protein"
FT                   /EC_number="1.6.99.-"
FT                   /note="identified by match to protein family HMM PF00881"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10212"
FT                   /db_xref="GOA:A8AVL7"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR016446"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVL7"
FT                   /protein_id="ABV10212.1"
FT                   PNQAIDQLFKEKKLEK"
FT   gene            556711..558021
FT                   /locus_tag="SGO_0512"
FT   CDS             556711..558021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0512"
FT                   /product="GTP-binding protein engA"
FT                   /note="identified by match to protein family HMM PF01926;
FT                   match to protein family HMM PF08477; match to protein
FT                   family HMM TIGR00231; match to protein family HMM
FT                   TIGR00650"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09995"
FT                   /db_xref="GOA:A8AVL8"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AVL8"
FT                   /protein_id="ABV09995.1"
FT   gene            558348..561437
FT                   /locus_tag="SGO_0513"
FT   CDS             558348..561437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0513"
FT                   /product="Snf2 family protein"
FT                   /EC_number="3.6.-.-"
FT                   /note="identified by match to protein family HMM PF00176;
FT                   match to protein family HMM PF00271; match to protein
FT                   family HMM PF04434; match to protein family HMM PF08455"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09552"
FT                   /db_xref="GOA:A8AVL9"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="InterPro:IPR013663"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVL9"
FT                   /protein_id="ABV09552.1"
FT   gene            561552..562139
FT                   /locus_tag="SGO_0514"
FT   CDS             561552..562139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0514"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10364"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVM0"
FT                   /protein_id="ABV10364.1"
FT   gene            562296..563627
FT                   /gene="murC"
FT                   /locus_tag="SGO_0515"
FT   CDS             562296..563627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /locus_tag="SGO_0515"
FT                   /product="UDP-N-acetylmuramate--alanine ligase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01225;
FT                   match to protein family HMM PF02875; match to protein
FT                   family HMM PF08245; match to protein family HMM TIGR01082"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10438"
FT                   /db_xref="GOA:A8AVM1"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AVM1"
FT                   /protein_id="ABV10438.1"
FT   gene            563640..564149
FT                   /locus_tag="SGO_0516"
FT   CDS             563640..564149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0516"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09908"
FT                   /db_xref="GOA:A8AVM2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVM2"
FT                   /protein_id="ABV09908.1"
FT                   NPYFKE"
FT   gene            564153..564653
FT                   /locus_tag="SGO_0517"
FT   CDS             564153..564653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0517"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09615"
FT                   /db_xref="GOA:A8AVM3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVM3"
FT                   /protein_id="ABV09615.1"
FT                   SKD"
FT   gene            564729..566360
FT                   /locus_tag="SGO_0518"
FT   CDS             564729..566360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0518"
FT                   /product="aminodeoxychorismate lyase-like protein"
FT                   /note="identified by match to protein family HMM PF02618;
FT                   match to protein family HMM TIGR00247"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10820"
FT                   /db_xref="GOA:A8AVM4"
FT                   /db_xref="InterPro:IPR003770"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVM4"
FT                   /protein_id="ABV10820.1"
FT   gene            566458..566940
FT                   /gene="greA"
FT                   /locus_tag="SGO_0519"
FT   CDS             566458..566940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="greA"
FT                   /locus_tag="SGO_0519"
FT                   /product="transcription elongation factor greA"
FT                   /note="identified by match to protein family HMM PF01272;
FT                   match to protein family HMM PF03449; match to protein
FT                   family HMM TIGR01462"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10285"
FT                   /db_xref="GOA:A8AVM5"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AVM5"
FT                   /protein_id="ABV10285.1"
FT   gene            566988..567092
FT                   /locus_tag="SGO_0520"
FT   CDS             566988..567092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0520"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09944"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVM6"
FT                   /protein_id="ABV09944.1"
FT   gene            complement(567641..568573)
FT                   /locus_tag="SGO_0521"
FT   CDS             complement(567641..568573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0521"
FT                   /product="Membrane protein oxaA 2 precursor"
FT                   /note="identified by match to protein family HMM PF02096"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09357"
FT                   /db_xref="GOA:A8AVM7"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR023060"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVM7"
FT                   /protein_id="ABV09357.1"
FT   gene            complement(568650..568928)
FT                   /locus_tag="SGO_0522"
FT   CDS             complement(568650..568928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0522"
FT                   /product="Acylphosphatase"
FT                   /note="identified by match to protein family HMM PF00708"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10595"
FT                   /db_xref="GOA:A8AVM8"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR020456"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVM8"
FT                   /protein_id="ABV10595.1"
FT   gene            568997..569737
FT                   /locus_tag="SGO_0523"
FT   CDS             568997..569737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0523"
FT                   /product="spoU rRNA Methylase family protein"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF00588;
FT                   match to protein family HMM PF08032"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10008"
FT                   /db_xref="GOA:A8AVM9"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVM9"
FT                   /protein_id="ABV10008.1"
FT   gene            569782..570273
FT                   /locus_tag="SGO_0524"
FT   CDS             569782..570273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0524"
FT                   /product="HD domain protein"
FT                   /note="identified by match to protein family HMM PF01966;
FT                   match to protein family HMM TIGR00277"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09699"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVN0"
FT                   /protein_id="ABV09699.1"
FT                   "
FT   gene            570291..570977
FT                   /locus_tag="SGO_0525"
FT   CDS             570291..570977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0525"
FT                   /product="membrane protein"
FT                   /note="identified by match to protein family HMM PF01027"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11159"
FT                   /db_xref="GOA:A8AVN1"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVN1"
FT                   /protein_id="ABV11159.1"
FT                   LFGRND"
FT   gene            571447..573162
FT                   /gene="ilvB"
FT                   /locus_tag="SGO_0526"
FT   CDS             571447..573162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvB"
FT                   /locus_tag="SGO_0526"
FT                   /product="acetolactate synthase, large subunit,
FT                   biosynthetic type"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00205;
FT                   match to protein family HMM PF02775; match to protein
FT                   family HMM PF02776; match to protein family HMM TIGR00118"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09423"
FT                   /db_xref="GOA:A8AVN2"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVN2"
FT                   /protein_id="ABV09423.1"
FT   gene            573155..573631
FT                   /gene="ilvN"
FT                   /locus_tag="SGO_0527"
FT   CDS             573155..573631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvN"
FT                   /locus_tag="SGO_0527"
FT                   /product="acetolactate synthase, small subunit"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01842;
FT                   match to protein family HMM TIGR00119"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09892"
FT                   /db_xref="GOA:A8AVN3"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVN3"
FT                   /protein_id="ABV09892.1"
FT   gene            573723..574745
FT                   /gene="ilvC"
FT                   /locus_tag="SGO_0528"
FT   CDS             573723..574745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvC"
FT                   /locus_tag="SGO_0528"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01450;
FT                   match to protein family HMM PF02629; match to protein
FT                   family HMM PF07991; match to protein family HMM TIGR00465"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10370"
FT                   /db_xref="GOA:A8AVN4"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AVN4"
FT                   /protein_id="ABV10370.1"
FT                   "
FT   gene            574932..576182
FT                   /gene="ilvA"
FT                   /locus_tag="SGO_0529"
FT   CDS             574932..576182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvA"
FT                   /locus_tag="SGO_0529"
FT                   /product="threonine dehydratase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00291;
FT                   match to protein family HMM PF00585; match to protein
FT                   family HMM TIGR02079"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10805"
FT                   /db_xref="GOA:A8AVN5"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR011820"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVN5"
FT                   /protein_id="ABV10805.1"
FT                   PGYINLHGNESLYNLLV"
FT   gene            complement(576332..577144)
FT                   /locus_tag="SGO_0530"
FT   CDS             complement(576332..577144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0530"
FT                   /product="Cof family protein"
FT                   /note="identified by match to protein family HMM PF05116;
FT                   match to protein family HMM PF08282; match to protein
FT                   family HMM TIGR00099; match to protein family HMM
FT                   TIGR01484"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09561"
FT                   /db_xref="GOA:A8AVN6"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVN6"
FT                   /protein_id="ABV09561.1"
FT   gene            577305..577907
FT                   /locus_tag="SGO_0531"
FT   CDS             577305..577907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0531"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF07099"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10147"
FT                   /db_xref="GOA:A8AVN7"
FT                   /db_xref="InterPro:IPR009793"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVN7"
FT                   /protein_id="ABV10147.1"
FT   gene            578013..579437
FT                   /locus_tag="SGO_0532"
FT   CDS             578013..579437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0532"
FT                   /product="xanthine/uracil permease family protein"
FT                   /note="identified by match to protein family HMM PF00860;
FT                   match to protein family HMM PF00916"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09532"
FT                   /db_xref="GOA:A8AVN8"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR026033"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVN8"
FT                   /protein_id="ABV09532.1"
FT                   LDALFILNFVSLALAK"
FT   gene            579484..579966
FT                   /locus_tag="SGO_0533"
FT   CDS             579484..579966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0533"
FT                   /product="conserved hypothetical protein TIGR00150"
FT                   /note="identified by match to protein family HMM PF02367;
FT                   match to protein family HMM TIGR00150"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10119"
FT                   /db_xref="GOA:A8AVN9"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVN9"
FT                   /protein_id="ABV10119.1"
FT   gene            579984..580490
FT                   /locus_tag="SGO_0534"
FT   CDS             579984..580490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0534"
FT                   /product="acetyltransferase, GNAT family"
FT                   /EC_number="2.3.1.-"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10445"
FT                   /db_xref="GOA:A8AVP0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVP0"
FT                   /protein_id="ABV10445.1"
FT                   GKLID"
FT   gene            580497..581708
FT                   /locus_tag="SGO_0535"
FT   CDS             580497..581708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0535"
FT                   /product="putative transcriptional regulator LytR"
FT                   /note="identified by match to protein family HMM PF03816;
FT                   match to protein family HMM TIGR00350"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11060"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVP1"
FT                   /protein_id="ABV11060.1"
FT                   TEAQ"
FT   gene            complement(581756..582058)
FT                   /locus_tag="SGO_0536"
FT   CDS             complement(581756..582058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0536"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11134"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVP2"
FT                   /protein_id="ABV11134.1"
FT   gene            complement(582069..582590)
FT                   /locus_tag="SGO_0537"
FT   CDS             complement(582069..582590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0537"
FT                   /product="HIT family protein"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01230"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09376"
FT                   /db_xref="GOA:A8AVP3"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVP3"
FT                   /protein_id="ABV09376.1"
FT                   LAAEISQAID"
FT   gene            582624..583355
FT                   /locus_tag="SGO_0538"
FT   CDS             582624..583355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0538"
FT                   /product="ABC transporter, ATP-binding protein SP0522"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09980"
FT                   /db_xref="GOA:A8AVP4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVP4"
FT                   /protein_id="ABV09980.1"
FT   gene            583352..584407
FT                   /locus_tag="SGO_0539"
FT   CDS             583352..584407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0539"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF05975"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10267"
FT                   /db_xref="GOA:A8AVP5"
FT                   /db_xref="InterPro:IPR010288"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVP5"
FT                   /protein_id="ABV10267.1"
FT                   YKLKGLVDERA"
FT   gene            584448..585242
FT                   /locus_tag="SGO_0540"
FT   CDS             584448..585242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0540"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01636"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10890"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVP6"
FT                   /protein_id="ABV10890.1"
FT   gene            585239..585877
FT                   /locus_tag="SGO_0541"
FT   CDS             585239..585877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0541"
FT                   /product="methyltransferase, putative"
FT                   /note="identified by match to protein family HMM PF02390;
FT                   match to protein family HMM TIGR00091"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10241"
FT                   /db_xref="GOA:A8AVP7"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AVP7"
FT                   /protein_id="ABV10241.1"
FT   gene            585986..586474
FT                   /locus_tag="SGO_0542"
FT   CDS             585986..586474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0542"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02576"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10710"
FT                   /db_xref="GOA:A8AVP8"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AVP8"
FT                   /protein_id="ABV10710.1"
FT   gene            586520..587761
FT                   /gene="nusA"
FT                   /locus_tag="SGO_0543"
FT   CDS             586520..587761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusA"
FT                   /locus_tag="SGO_0543"
FT                   /product="transcription termination factor NusA"
FT                   /note="identified by match to protein family HMM PF00013;
FT                   match to protein family HMM PF00575; match to protein
FT                   family HMM PF08529; match to protein family HMM TIGR01953"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11175"
FT                   /db_xref="GOA:A8AVP9"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVP9"
FT                   /protein_id="ABV11175.1"
FT                   LATDLEESEVTELD"
FT   gene            587772..588068
FT                   /locus_tag="SGO_0544"
FT   CDS             587772..588068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0544"
FT                   /product="Protein of unknown function (DUF448) superfamily"
FT                   /note="identified by match to protein family HMM PF04296"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09387"
FT                   /db_xref="InterPro:IPR007393"
FT                   /db_xref="InterPro:IPR035931"
FT                   /db_xref="InterPro:IPR037465"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVQ0"
FT                   /protein_id="ABV09387.1"
FT   gene            588061..588360
FT                   /locus_tag="SGO_0545"
FT   CDS             588061..588360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0545"
FT                   /product="ribosomal protein L7A family"
FT                   /note="identified by match to protein family HMM PF01248"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09978"
FT                   /db_xref="GOA:A8AVQ1"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVQ1"
FT                   /protein_id="ABV09978.1"
FT   gene            588378..591239
FT                   /gene="infB"
FT                   /locus_tag="SGO_0546"
FT   CDS             588378..591239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infB"
FT                   /locus_tag="SGO_0546"
FT                   /product="Translation initiation factor IF-2"
FT                   /note="identified by match to protein family HMM PF00009;
FT                   match to protein family HMM PF01926; match to protein
FT                   family HMM PF03144; match to protein family HMM PF04760;
FT                   match to protein family HMM TIGR00231; match to protein
FT                   family HMM TIGR00487"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09252"
FT                   /db_xref="GOA:A8AVQ2"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AVQ2"
FT                   /protein_id="ABV09252.1"
FT   gene            591425..591772
FT                   /gene="rbfA"
FT                   /locus_tag="SGO_0547"
FT   CDS             591425..591772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbfA"
FT                   /locus_tag="SGO_0547"
FT                   /product="ribosome-binding factor A"
FT                   /note="identified by match to protein family HMM PF02033;
FT                   match to protein family HMM TIGR00082"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09662"
FT                   /db_xref="GOA:A8AVQ3"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AVQ3"
FT                   /protein_id="ABV09662.1"
FT                   KIDQMLRDLDK"
FT   gene            591917..593548
FT                   /locus_tag="SGO_0548"
FT   CDS             591917..593548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0548"
FT                   /product="Na/Pi-cotransporter family protein"
FT                   /note="identified by match to protein family HMM PF01895;
FT                   match to protein family HMM PF02690; match to protein
FT                   family HMM TIGR00704"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09205"
FT                   /db_xref="GOA:A8AVQ4"
FT                   /db_xref="InterPro:IPR003841"
FT                   /db_xref="InterPro:IPR004633"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVQ4"
FT                   /protein_id="ABV09205.1"
FT   gene            593710..594861
FT                   /gene="nagA"
FT                   /locus_tag="SGO_0549"
FT   CDS             593710..594861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagA"
FT                   /locus_tag="SGO_0549"
FT                   /product="N-acetylglucosamine-6-phosphate deacetylase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01979;
FT                   match to protein family HMM TIGR00221"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10537"
FT                   /db_xref="GOA:A8AVQ5"
FT                   /db_xref="InterPro:IPR003764"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVQ5"
FT                   /protein_id="ABV10537.1"
FT   gene            594836..594982
FT                   /locus_tag="SGO_0550"
FT   CDS             594836..594982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0550"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10076"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVQ6"
FT                   /protein_id="ABV10076.1"
FT                   FMI"
FT   gene            595013..595210
FT                   /locus_tag="SGO_0551"
FT   CDS             595013..595210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0551"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09366"
FT                   /db_xref="GOA:A8AVQ7"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVQ7"
FT                   /protein_id="ABV09366.1"
FT   gene            595290..596135
FT                   /locus_tag="SGO_0552"
FT   CDS             595290..596135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0552"
FT                   /product="oxidoreductase, aldo/keto reductase family"
FT                   /EC_number="1.1.-.-"
FT                   /note="identified by match to protein family HMM PF00248"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10986"
FT                   /db_xref="GOA:A8AVQ8"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVQ8"
FT                   /protein_id="ABV10986.1"
FT                   "
FT   gene            596136..596588
FT                   /locus_tag="SGO_0553"
FT   CDS             596136..596588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0553"
FT                   /product="acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10493"
FT                   /db_xref="GOA:A8AVQ9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVQ9"
FT                   /protein_id="ABV10493.1"
FT   gene            596725..599712
FT                   /gene="hsdR"
FT                   /locus_tag="SGO_0554"
FT   CDS             596725..599712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsdR"
FT                   /locus_tag="SGO_0554"
FT                   /product="type I site-specific deoxyribonuclease"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF04313;
FT                   match to protein family HMM PF04851; match to protein
FT                   family HMM TIGR00348"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09935"
FT                   /db_xref="GOA:A8AVR0"
FT                   /db_xref="InterPro:IPR004473"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022625"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVR0"
FT                   /protein_id="ABV09935.1"
FT                   PLRVGR"
FT   gene            599723..600574
FT                   /locus_tag="SGO_0555"
FT   CDS             599723..600574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0555"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10144"
FT                   /db_xref="InterPro:IPR014976"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVR1"
FT                   /protein_id="ABV10144.1"
FT                   TI"
FT   gene            600516..602996
FT                   /locus_tag="SGO_0556"
FT   CDS             600516..602996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0556"
FT                   /product="DNA helicase-like protein, putative"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10574"
FT                   /db_xref="GOA:A8AVR2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVR2"
FT                   /protein_id="ABV10574.1"
FT                   GILISEVKLNMREL"
FT   gene            603001..604209
FT                   /locus_tag="SGO_0557"
FT   CDS             603001..604209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0557"
FT                   /product="HsdS specificity protein of type I
FT                   restriction-modification system"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01420"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11142"
FT                   /db_xref="GOA:A8AVR3"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVR3"
FT                   /protein_id="ABV11142.1"
FT                   MFI"
FT   gene            604233..604997
FT                   /locus_tag="SGO_0558"
FT   CDS             604233..604997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0558"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10567"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVR4"
FT                   /protein_id="ABV10567.1"
FT   gene            605068..605946
FT                   /locus_tag="SGO_0559"
FT   CDS             605068..605946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0559"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09952"
FT                   /db_xref="InterPro:IPR025332"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVR5"
FT                   /protein_id="ABV09952.1"
FT                   PEFIDSFNPNN"
FT   gene            605957..607564
FT                   /gene="hsdM"
FT                   /locus_tag="SGO_0560"
FT   CDS             605957..607564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsdM"
FT                   /locus_tag="SGO_0560"
FT                   /product="type I restriction-modification system, M
FT                   subunit"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF02384;
FT                   match to protein family HMM TIGR00497"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10934"
FT                   /db_xref="GOA:A8AVR6"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR004546"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVR6"
FT                   /protein_id="ABV10934.1"
FT                   TTPEADAELKQFLKEFKG"
FT   gene            607694..608032
FT                   /locus_tag="SGO_0561"
FT   CDS             607694..608032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0561"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10353"
FT                   /db_xref="InterPro:IPR007711"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVR7"
FT                   /protein_id="ABV10353.1"
FT                   EEVSNHYE"
FT   gene            608025..609110
FT                   /locus_tag="SGO_0562"
FT   CDS             608025..609110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0562"
FT                   /product="Helix-turn-helix domain protein"
FT                   /note="identified by match to protein family HMM PF01381;
FT                   match to protein family HMM PF06114; match to protein
FT                   family HMM TIGR02607"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09877"
FT                   /db_xref="GOA:A8AVR8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR013430"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVR8"
FT                   /protein_id="ABV09877.1"
FT   gene            609295..609480
FT                   /locus_tag="SGO_0563"
FT   CDS             609295..609480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0563"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09626"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVR9"
FT                   /protein_id="ABV09626.1"
FT                   VYLLFIQIPTYNILLY"
FT   gene            609493..609858
FT                   /locus_tag="SGO_0564"
FT   CDS             609493..609858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0564"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM TIGR02328"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10781"
FT                   /db_xref="InterPro:IPR004260"
FT                   /db_xref="InterPro:IPR012650"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVS0"
FT                   /protein_id="ABV10781.1"
FT                   YYEECLDNLREKGIDLE"
FT   gene            complement(610155..611177)
FT                   /gene="adhA"
FT                   /locus_tag="SGO_0565"
FT   CDS             complement(610155..611177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adhA"
FT                   /locus_tag="SGO_0565"
FT                   /product="alcohol dehydrogenase"
FT                   /EC_number="1.-.-.-"
FT                   /note="identified by match to protein family HMM PF00107;
FT                   match to protein family HMM PF08240"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10952"
FT                   /db_xref="GOA:A8AVS1"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVS1"
FT                   /protein_id="ABV10952.1"
FT                   "
FT   gene            611500..616041
FT                   /gene="sgc"
FT                   /locus_tag="SGO_0566"
FT   CDS             611500..616041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sgc"
FT                   /locus_tag="SGO_0566"
FT                   /product="serine protease challisin"
FT                   /EC_number="3.4.21.-"
FT                   /note="identified by match to protein family HMM PF00082;
FT                   match to protein family HMM PF02225; match to protein
FT                   family HMM PF04650; match to protein family HMM PF06280;
FT                   match to protein family HMM PF07554; match to protein
FT                   family HMM TIGR01168"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11082"
FT                   /db_xref="GOA:A8AVS2"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR005877"
FT                   /db_xref="InterPro:IPR009063"
FT                   /db_xref="InterPro:IPR010435"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034216"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVS2"
FT                   /protein_id="ABV11082.1"
FT   gene            616290..616382
FT                   /locus_tag="SGO_0567"
FT   CDS             616290..616382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0567"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11090"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVS3"
FT                   /protein_id="ABV11090.1"
FT                   /translation="MTPLGRNSLGLSDVVLLFVQTEQKMVPELK"
FT   gene            616401..617318
FT                   /gene="glyQ"
FT                   /locus_tag="SGO_0568"
FT   CDS             616401..617318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyQ"
FT                   /locus_tag="SGO_0568"
FT                   /product="glycyl-tRNA synthetase, alpha subunit"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF02091;
FT                   match to protein family HMM TIGR00388"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10626"
FT                   /db_xref="GOA:A8AVS4"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AVS4"
FT                   /protein_id="ABV10626.1"
FT   gene            617321..619360
FT                   /gene="glyS"
FT                   /locus_tag="SGO_0569"
FT   CDS             617321..619360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="SGO_0569"
FT                   /product="glycyl-tRNA synthetase, beta subunit"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF02092;
FT                   match to protein family HMM PF05746; match to protein
FT                   family HMM TIGR00211"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10025"
FT                   /db_xref="GOA:A8AVS5"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AVS5"
FT                   /protein_id="ABV10025.1"
FT   gene            619383..619640
FT                   /locus_tag="SGO_0570"
FT   CDS             619383..619640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0570"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05979"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10875"
FT                   /db_xref="GOA:A8AVS6"
FT                   /db_xref="InterPro:IPR009242"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AVS6"
FT                   /protein_id="ABV10875.1"
FT   gene            complement(619855..620394)
FT                   /locus_tag="SGO_0571"
FT   CDS             complement(619855..620394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0571"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09898"
FT                   /db_xref="GOA:A8AVS7"
FT                   /db_xref="InterPro:IPR021697"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVS7"
FT                   /protein_id="ABV09898.1"
FT                   IAKGKIRQAQKREEEE"
FT   gene            complement(620440..620655)
FT                   /locus_tag="SGO_0572"
FT   CDS             complement(620440..620655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0572"
FT                   /product="transcription regulator"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09165"
FT                   /db_xref="GOA:A8AVS8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVS8"
FT                   /protein_id="ABV09165.1"
FT   gene            620840..621790
FT                   /gene="mraW"
FT                   /locus_tag="SGO_0573"
FT   CDS             620840..621790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraW"
FT                   /locus_tag="SGO_0573"
FT                   /product="S-adenosyl-methyltransferase MraW"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF01795;
FT                   match to protein family HMM TIGR00006"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11077"
FT                   /db_xref="GOA:A8AVS9"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AVS9"
FT                   /protein_id="ABV11077.1"
FT   gene            621799..622119
FT                   /gene="FtsL"
FT                   /locus_tag="SGO_0574"
FT   CDS             621799..622119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="FtsL"
FT                   /locus_tag="SGO_0574"
FT                   /product="cell division protein FtsL"
FT                   /note="identified by match to protein family HMM TIGR02209"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10639"
FT                   /db_xref="GOA:A8AVT0"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVT0"
FT                   /protein_id="ABV10639.1"
FT                   AE"
FT   gene            622123..624378
FT                   /gene="pbp2X"
FT                   /locus_tag="SGO_0575"
FT   CDS             622123..624378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbp2X"
FT                   /locus_tag="SGO_0575"
FT                   /product="penicillin-binding protein 2X"
FT                   /EC_number="2.3.2.-"
FT                   /note="identified by match to protein family HMM PF00905;
FT                   match to protein family HMM PF03717; match to protein
FT                   family HMM PF03793"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10648"
FT                   /db_xref="GOA:A8AVT1"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVT1"
FT                   /protein_id="ABV10648.1"
FT   gene            624380..625363
FT                   /gene="mraY"
FT                   /locus_tag="SGO_0576"
FT   CDS             624380..625363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraY"
FT                   /locus_tag="SGO_0576"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00953;
FT                   match to protein family HMM TIGR00445"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10526"
FT                   /db_xref="GOA:A8AVT2"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AVT2"
FT                   /protein_id="ABV10526.1"
FT   gene            625463..626806
FT                   /locus_tag="SGO_0577"
FT   CDS             625463..626806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0577"
FT                   /product="ATP-dependent RNA helicase"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09465"
FT                   /db_xref="GOA:A8AVT3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030881"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVT3"
FT                   /protein_id="ABV09465.1"
FT   gene            626976..627785
FT                   /locus_tag="SGO_0578"
FT   CDS             626976..627785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0578"
FT                   /product="amino acid ABC transporter permease protein"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR01726"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11089"
FT                   /db_xref="GOA:A8AVT4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVT4"
FT                   /protein_id="ABV11089.1"
FT   gene            627785..628528
FT                   /locus_tag="SGO_0579"
FT   CDS             627785..628528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0579"
FT                   /product="amino acid ABC transporter ATP binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10657"
FT                   /db_xref="GOA:A8AVT5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVT5"
FT                   /protein_id="ABV10657.1"
FT   gene            628634..628858
FT                   /locus_tag="SGO_0580"
FT   CDS             628634..628858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0580"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10235"
FT                   /db_xref="GOA:A8AVT6"
FT                   /db_xref="InterPro:IPR025134"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVT6"
FT                   /protein_id="ABV10235.1"
FT   gene            628922..629836
FT                   /gene="trxB"
FT                   /locus_tag="SGO_0581"
FT   CDS             628922..629836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxB"
FT                   /locus_tag="SGO_0581"
FT                   /product="thioredoxin-disulfide reductase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF01134; match to protein
FT                   family HMM PF01266; match to protein family HMM PF03486;
FT                   match to protein family HMM PF07992; match to protein
FT                   family HMM TIGR01292"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09235"
FT                   /db_xref="GOA:A8AVT7"
FT                   /db_xref="InterPro:IPR000103"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVT7"
FT                   /protein_id="ABV09235.1"
FT   gene            630049..631509
FT                   /locus_tag="SGO_0582"
FT   CDS             630049..631509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0582"
FT                   /product="nicotinate phosphoribosyltransferase, putative"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF04095;
FT                   match to protein family HMM TIGR01513"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10859"
FT                   /db_xref="GOA:A8AVT8"
FT                   /db_xref="InterPro:IPR006405"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVT8"
FT                   /protein_id="ABV10859.1"
FT   gene            631506..632330
FT                   /gene="nadE"
FT                   /locus_tag="SGO_0583"
FT   CDS             631506..632330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadE"
FT                   /locus_tag="SGO_0583"
FT                   /product="NAD+ synthetase"
FT                   /note="identified by match to protein family HMM PF02540;
FT                   match to protein family HMM TIGR00552"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10367"
FT                   /db_xref="GOA:A8AVT9"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022926"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AVT9"
FT                   /protein_id="ABV10367.1"
FT   gene            632378..632938
FT                   /locus_tag="SGO_0584"
FT   CDS             632378..632938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0584"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09953"
FT                   /db_xref="GOA:A8AVU0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVU0"
FT                   /protein_id="ABV09953.1"
FT   gene            633017..634351
FT                   /gene="pepC"
FT                   /locus_tag="SGO_0585"
FT   CDS             633017..634351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepC"
FT                   /locus_tag="SGO_0585"
FT                   /product="aminopeptidase C"
FT                   /EC_number="3.4.22.-"
FT                   /note="identified by match to protein family HMM PF03051"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10984"
FT                   /db_xref="GOA:A8AVU1"
FT                   /db_xref="InterPro:IPR000169"
FT                   /db_xref="InterPro:IPR004134"
FT                   /db_xref="InterPro:IPR025660"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVU1"
FT                   /protein_id="ABV10984.1"
FT   gene            complement(634463..636601)
FT                   /gene="pbp1a"
FT                   /locus_tag="SGO_0586"
FT   CDS             complement(634463..636601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbp1a"
FT                   /locus_tag="SGO_0586"
FT                   /product="penicillin-binding protein 1A"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00905;
FT                   match to protein family HMM PF00912; match to protein
FT                   family HMM TIGR02074"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09289"
FT                   /db_xref="GOA:A8AVU2"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVU2"
FT                   /protein_id="ABV09289.1"
FT                   SSTSNPQENKPQTNNGQR"
FT   gene            complement(636594..637196)
FT                   /gene="recU"
FT                   /locus_tag="SGO_0587"
FT   CDS             complement(636594..637196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recU"
FT                   /locus_tag="SGO_0587"
FT                   /product="Recombination protein U"
FT                   /note="identified by match to protein family HMM PF03838;
FT                   match to protein family HMM TIGR00648"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10217"
FT                   /db_xref="GOA:A8AVU3"
FT                   /db_xref="InterPro:IPR004612"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AVU3"
FT                   /protein_id="ABV10217.1"
FT   gene            637262..637789
FT                   /locus_tag="SGO_0588"
FT   CDS             637262..637789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0588"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06908"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09401"
FT                   /db_xref="InterPro:IPR010697"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AVU4"
FT                   /protein_id="ABV09401.1"
FT                   DLNEMAENFSEI"
FT   gene            637859..638209
FT                   /locus_tag="SGO_0589"
FT   CDS             637859..638209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0589"
FT                   /product="methylase"
FT                   /note="identified by match to protein family HMM PF05103"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10093"
FT                   /db_xref="GOA:A8AVU5"
FT                   /db_xref="InterPro:IPR007793"
FT                   /db_xref="InterPro:IPR011229"
FT                   /db_xref="InterPro:IPR019933"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AVU5"
FT                   /protein_id="ABV10093.1"
FT                   GKQIQASELNQL"
FT   gene            638750..639916
FT                   /locus_tag="SGO_0590"
FT   CDS             638750..639916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0590"
FT                   /product="Methyltransferase"
FT                   /note="identified by match to protein family HMM PF01170"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10989"
FT                   /db_xref="GOA:A8AVU6"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVU6"
FT                   /protein_id="ABV10989.1"
FT   gene            639919..641325
FT                   /locus_tag="SGO_0591"
FT   CDS             639919..641325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0591"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09157"
FT                   /db_xref="GOA:A8AVU7"
FT                   /db_xref="InterPro:IPR030858"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVU7"
FT                   /protein_id="ABV09157.1"
FT                   GPGYADSLDY"
FT   gene            complement(641386..641868)
FT                   /gene="luxS"
FT                   /locus_tag="SGO_0592"
FT   CDS             complement(641386..641868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="luxS"
FT                   /locus_tag="SGO_0592"
FT                   /product="autoinducer-2 production protein LuxS"
FT                   /note="identified by match to protein family HMM PF02664"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09736"
FT                   /db_xref="GOA:Q8KQK6"
FT                   /db_xref="InterPro:IPR003815"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR037005"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8KQK6"
FT                   /protein_id="ABV09736.1"
FT   gene            642100..643707
FT                   /locus_tag="SGO_0593"
FT   CDS             642100..643707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0593"
FT                   /product="HD/KH domain protein"
FT                   /note="identified by match to protein family HMM PF00013;
FT                   match to protein family HMM PF01966; match to protein
FT                   family HMM TIGR00277; match to protein family HMM
FT                   TIGR03319"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10309"
FT                   /db_xref="GOA:A8AVU9"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR017705"
FT                   /db_xref="InterPro:IPR022711"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AVU9"
FT                   /protein_id="ABV10309.1"
FT                   GNIKVTVIRELRAVDYAK"
FT   gene            643822..644448
FT                   /gene="gmk"
FT                   /locus_tag="SGO_0594"
FT   CDS             643822..644448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmk"
FT                   /locus_tag="SGO_0594"
FT                   /product="Guanylate kinase (GMP kinase)"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00625"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11094"
FT                   /db_xref="GOA:A8AVV0"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVV0"
FT                   /protein_id="ABV11094.1"
FT   gene            644476..644787
FT                   /locus_tag="SGO_0595"
FT   CDS             644476..644787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0595"
FT                   /product="DNA-directed RNA polymerase, omega subunit"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01192;
FT                   match to protein family HMM TIGR00690"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09478"
FT                   /db_xref="GOA:A8AVV1"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVV1"
FT                   /protein_id="ABV09478.1"
FT   gene            644908..647289
FT                   /gene="priA"
FT                   /locus_tag="SGO_0596"
FT   CDS             644908..647289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="priA"
FT                   /locus_tag="SGO_0596"
FT                   /product="primosomal protein N''"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271; match to protein
FT                   family HMM PF04851; match to protein family HMM TIGR00595"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09957"
FT                   /db_xref="GOA:A8AVV2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVV2"
FT                   /protein_id="ABV09957.1"
FT   gene            647302..648237
FT                   /gene="fmt"
FT                   /locus_tag="SGO_0597"
FT   CDS             647302..648237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /locus_tag="SGO_0597"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00551;
FT                   match to protein family HMM PF02911; match to protein
FT                   family HMM TIGR00460"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10866"
FT                   /db_xref="GOA:A8AVV3"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AVV3"
FT                   /protein_id="ABV10866.1"
FT   gene            648227..649540
FT                   /gene="sun"
FT                   /locus_tag="SGO_0598"
FT   CDS             648227..649540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sun"
FT                   /locus_tag="SGO_0598"
FT                   /product="sun protein"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF01029;
FT                   match to protein family HMM PF01189; match to protein
FT                   family HMM TIGR00563"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09358"
FT                   /db_xref="GOA:A8AVV4"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVV4"
FT                   /protein_id="ABV09358.1"
FT   gene            649561..650301
FT                   /locus_tag="SGO_0599"
FT   CDS             649561..650301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0599"
FT                   /product="phosphoprotein phosphatase"
FT                   /EC_number="3.1.3.-"
FT                   /note="identified by match to protein family HMM PF00481"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09792"
FT                   /db_xref="GOA:A8AVV5"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVV5"
FT                   /protein_id="ABV09792.1"
FT   gene            650298..652151
FT                   /locus_tag="SGO_0600"
FT   CDS             650298..652151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0600"
FT                   /product="serine/threonine protein kinase"
FT                   /EC_number="2.7.1.-"
FT                   /note="identified by match to protein family HMM PF00069;
FT                   match to protein family HMM PF03793"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10270"
FT                   /db_xref="GOA:A8AVV6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVV6"
FT                   /protein_id="ABV10270.1"
FT   gene            652325..653023
FT                   /locus_tag="SGO_0601"
FT   CDS             652325..653023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0601"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09350"
FT                   /db_xref="GOA:A8AVV7"
FT                   /db_xref="InterPro:IPR016975"
FT                   /db_xref="InterPro:IPR024425"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVV7"
FT                   /protein_id="ABV09350.1"
FT                   LIGNVEVVRK"
FT   gene            653068..654021
FT                   /locus_tag="SGO_0602"
FT   CDS             653068..654021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0602"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="identified by match to protein family HMM PF02518;
FT                   match to protein family HMM PF07730"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09779"
FT                   /db_xref="GOA:A8AVV8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR017202"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVV8"
FT                   /protein_id="ABV09779.1"
FT   gene            654011..654655
FT                   /locus_tag="SGO_0603"
FT   CDS             654011..654655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0603"
FT                   /product="response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00196; match to protein
FT                   family HMM PF08281"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10089"
FT                   /db_xref="GOA:A8AVV9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVV9"
FT                   /protein_id="ABV10089.1"
FT   gene            654743..656146
FT                   /locus_tag="SGO_0604"
FT   CDS             654743..656146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0604"
FT                   /product="hydrolase, haloacid dehalogenase
FT                   family/peptidyl-prolyl cis-trans isomerase, cyclophilin
FT                   type"
FT                   /note="identified by match to protein family HMM PF00160;
FT                   match to protein family HMM PF00702; match to protein
FT                   family HMM PF05116; match to protein family HMM PF08282;
FT                   match to protein family HMM TIGR00099; match to protein
FT                   family HMM TIGR01484"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09316"
FT                   /db_xref="GOA:A8AVW0"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVW0"
FT                   /protein_id="ABV09316.1"
FT                   IETIEVEDE"
FT   gene            656143..656529
FT                   /locus_tag="SGO_0605"
FT   CDS             656143..656529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0605"
FT                   /product="general stress protein GSP13"
FT                   /note="identified by match to protein family HMM PF00575"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10194"
FT                   /db_xref="GOA:A8AVW1"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVW1"
FT                   /protein_id="ABV10194.1"
FT   gene            complement(656566..657495)
FT                   /gene="cysK"
FT                   /locus_tag="SGO_0606"
FT   CDS             complement(656566..657495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysK"
FT                   /locus_tag="SGO_0606"
FT                   /product="cysteine synthase A"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00291;
FT                   match to protein family HMM TIGR01136; match to protein
FT                   family HMM TIGR01139"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10101"
FT                   /db_xref="GOA:A8AVW2"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVW2"
FT                   /protein_id="ABV10101.1"
FT   gene            complement(657593..658240)
FT                   /locus_tag="SGO_0607"
FT   CDS             complement(657593..658240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0607"
FT                   /product="conserved hypothetical protein TIGR00257"
FT                   /note="identified by match to protein family HMM PF01205;
FT                   match to protein family HMM TIGR00257"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09584"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR015796"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVW3"
FT                   /protein_id="ABV09584.1"
FT   gene            658281..659582
FT                   /gene="comFA"
FT                   /locus_tag="SGO_0608"
FT   CDS             658281..659582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comFA"
FT                   /locus_tag="SGO_0608"
FT                   /product="competence ComFA-like protein"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10643"
FT                   /db_xref="GOA:A8AVW4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVW4"
FT                   /protein_id="ABV10643.1"
FT   gene            659579..660244
FT                   /gene="comFC"
FT                   /locus_tag="SGO_0609"
FT   CDS             659579..660244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comFC"
FT                   /locus_tag="SGO_0609"
FT                   /product="competence protein ComFC"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10087"
FT                   /db_xref="GOA:A8AVW5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVW5"
FT                   /protein_id="ABV10087.1"
FT   gene            660330..660872
FT                   /locus_tag="SGO_0610"
FT   CDS             660330..660872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0610"
FT                   /product="ribosomal subunit interface protein"
FT                   /note="identified by match to protein family HMM PF02482;
FT                   match to protein family HMM TIGR00741"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABV09464"
FT                   /db_xref="GOA:A8AVW6"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVW6"
FT                   /protein_id="ABV09464.1"
FT                   NVIYRREDGDLGLLEVK"
FT   gene            661162..662671
FT                   /gene="rrsA"
FT                   /locus_tag="SGO_0611"
FT   rRNA            661162..662671
FT                   /gene="rrsA"
FT                   /locus_tag="SGO_0611"
FT                   /product="16S ribosomal RNA"
FT   gene            662763..662835
FT                   /locus_tag="SGO_0612"
FT   tRNA            662763..662835
FT                   /locus_tag="SGO_0612"
FT                   /product="tRNA-Ala"
FT   gene            662956..665855
FT                   /gene="rrlA"
FT                   /locus_tag="SGO_0613"
FT   rRNA            662956..665855
FT                   /gene="rrlA"
FT                   /locus_tag="SGO_0613"
FT                   /product="23S ribosomal RNA"
FT   gene            665936..666051
FT                   /gene="rrfA"
FT                   /locus_tag="SGO_0614"
FT   rRNA            665936..666051
FT                   /gene="rrfA"
FT                   /locus_tag="SGO_0614"
FT                   /product="5S ribosomal RNA"
FT   gene            666182..666254
FT                   /locus_tag="SGO_0615"
FT   tRNA            666182..666254
FT                   /locus_tag="SGO_0615"
FT                   /product="tRNA-Val"
FT   gene            666257..666329
FT                   /locus_tag="SGO_0616"
FT   tRNA            666257..666329
FT                   /locus_tag="SGO_0616"
FT                   /product="tRNA-Asp"
FT   gene            666357..666429
FT                   /locus_tag="SGO_0617"
FT   tRNA            666357..666429
FT                   /locus_tag="SGO_0617"
FT                   /product="tRNA-Lys"
FT   gene            666435..666516
FT                   /locus_tag="SGO_0618"
FT   tRNA            666435..666516
FT                   /locus_tag="SGO_0618"
FT                   /product="tRNA-Leu"
FT   gene            666527..666599
FT                   /locus_tag="SGO_0619"
FT   tRNA            666527..666599
FT                   /locus_tag="SGO_0619"
FT                   /product="tRNA-Thr"
FT   gene            666620..666691
FT                   /locus_tag="SGO_0620"
FT   tRNA            666620..666691
FT                   /locus_tag="SGO_0620"
FT                   /product="tRNA-Gly"
FT   gene            666697..666782
FT                   /locus_tag="SGO_0621"
FT   tRNA            666697..666782
FT                   /locus_tag="SGO_0621"
FT                   /product="tRNA-Leu"
FT   gene            666796..666869
FT                   /locus_tag="SGO_0622"
FT   tRNA            666796..666869
FT                   /locus_tag="SGO_0622"
FT                   /product="tRNA-Arg"
FT   gene            666898..666971
FT                   /locus_tag="SGO_0623"
FT   tRNA            666898..666971
FT                   /locus_tag="SGO_0623"
FT                   /product="tRNA-Pro"
FT   gene            complement(667072..667389)
FT                   /locus_tag="SGO_0624"
FT   CDS             complement(667072..667389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGO_0624"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGO_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABV10936"
FT                   /db_xref="InterPro:IPR009303"
FT                   /db_xref="UniProtKB/TrEMBL:A8AVW7"
FT                   /protein_id="ABV10936.1"
FT                   M"
FT   gene            complement(667505..668038)
FT                   /locus_tag="SGO_0625"
FT   CDS             complement(667505..668038)