Dbfetch

ID   BC132163; SV 1; linear; mRNA; STD; MUS; 1041 BP.
XX
AC   BC132163;
XX
DT   31-JAN-2007 (Rel. 90, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus histocompatibility 2, class II antigen E beta, mRNA (cDNA
DE   clone MGC:163794 IMAGE:40130440), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1041
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1041
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (29-JAN-2007) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; e9444bb91a1c9257640d0fd0f7033dfa.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Ambion
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRCK Plate: 5 Row: L Column: 1.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1041
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_377"
FT                   /clone="MGC:163794 IMAGE:40130440"
FT                   /tissue_type="Brain, PCR rescued clones"
FT                   /note="Vector: pCR4-TOPO; Clone identification sequence
FT                   tag: TTCCGTTT"
FT                   /db_xref="taxon:10090"
FT   gene            1..1041
FT                   /gene="H2-Eb1"
FT                   /note="synonyms: E-beta-b, H-2E beta, H2-Eb, H2Eb"
FT   CDS             38..832
FT                   /codon_start=1
FT                   /gene="H2-Eb1"
FT                   /product="H2-Eb1 protein"
FT                   /db_xref="GOA:Q3U1H1"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="MGI:MGI:95901"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U1H1"
FT                   /protein_id="AAI32164.1"
FT                   /translation="MVWLPRVPCVAAVILLLTVLSPPVALVRDSRPWFLEYCKSECHFY
FT                   NGTQRVRFLKRYFYNLEENLRFDSDVGEFRAVTELGRPDAENWNSQPEILEQKRAAVDT
FT                   YCRHNYEIFDNFLVRRRVEPTVTVYPTKTQPLEHHNLLVCSVSDFYPGNIEVRWFRNGK
FT                   EEKTGIVSTGLVRNGDWTFQTLVMLETVPQSGEVYTCQVEHPSLTDPVTVEWKAQSTSA
FT                   QNKMLSGVGGFVLGLLFLGAGLFIYFRNQKGQSGLQPTGLLS"
FT   misc_difference 194
FT                   /gene="H2-Eb1"
FT                   /note="'T' in cDNA is 'C' in the mouse genome; amino acid
FT                   difference: 'F' in cDNA, 'L' in the mouse genome."
FT   misc_difference 200
FT                   /gene="H2-Eb1"
FT                   /note="'A' in cDNA is 'G' in the mouse genome; amino acid
FT                   difference: 'K' in cDNA, 'E' in the mouse genome."
FT   misc_difference 317
FT                   /gene="H2-Eb1"
FT                   /note="'A' in cDNA is 'T' in the mouse genome; amino acid
FT                   difference: 'I' in cDNA, 'F' in the mouse genome."
FT   misc_difference 339
FT                   /gene="H2-Eb1"
FT                   /note="'C' in cDNA is 'A' in the mouse genome; amino acid
FT                   difference: 'A' in cDNA, 'E' in the mouse genome."
FT   misc_difference 350..352
FT                   /gene="H2-Eb1"
FT                   /note="in the mouse genome : GTG."
FT   misc_difference 375..376
FT                   /gene="H2-Eb1"
FT                   /note="in the mouse genome : CG."
FT   misc_difference 382
FT                   /gene="H2-Eb1"
FT                   /note="'C' in cDNA is 'A' in the mouse genome; amino acid
FT                   difference: 'N' in cDNA, 'K' in the mouse genome."
FT   misc_difference 436
FT                   /gene="H2-Eb1"
FT                   /note="'G' in cDNA is 'A' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 691
FT                   /gene="H2-Eb1"
FT                   /note="'G' in cDNA is 'A' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 748
FT                   /gene="H2-Eb1"
FT                   /note="'C' in cDNA is 'G' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 757
FT                   /gene="H2-Eb1"
FT                   /note="'C' in cDNA is 'G' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 860
FT                   /gene="H2-Eb1"
FT                   /note="'G' in cDNA is 'A' in the mouse genome."
FT   misc_difference 869
FT                   /gene="H2-Eb1"
FT                   /note="1 base in cDNA is not found in the mouse genome."
FT   misc_difference 988
FT                   /gene="H2-Eb1"
FT                   /note="'C' in cDNA is 'T' in the mouse genome."
FT   misc_difference 1020
FT                   /gene="H2-Eb1"
FT                   /note="'A' in cDNA is 'G' in the mouse genome."
XX
SQ   Sequence 1041 BP; 227 A; 300 C; 291 G; 223 T; 0 other;
     ccttcccctc tgactcctgt gtctcctctc ctgcagcatg gtgtggctcc ccagagttcc        60
     ctgtgtggca gctgtgatcc tgttgctgac agtgctgagc cctccagtgg ctttggtcag       120
     agactccaga ccatggtttt tggaatactg taaatctgag tgtcatttct acaacgggac       180
     gcagcgcgtg cggtttctga aaagatactt ctacaacctg gaggagaacc tgcgcttcga       240
     cagcgacgtg ggcgagttcc gcgcggtgac cgagctgggg cggccagacg ccgagaactg       300
     gaacagccag ccggagatcc tggagcaaaa gcgggccgcg gtggacacgt actgcagaca       360
     caactatgag atcttcgata acttccttgt gcggcggaga gttgagccta cggtgactgt       420
     gtaccccaca aagacgcagc ccctggaaca ccacaacctc ctggtctgct ctgtgagtga       480
     cttctaccct ggcaacattg aagtcagatg gttccggaat ggcaaggagg agaaaacagg       540
     aattgtgtcc acgggcctgg tccgaaatgg agactggacc ttccagacac tggtgatgct       600
     ggagacggtt cctcagagtg gagaggttta cacctgccag gtggagcatc ccagcctgac       660
     cgaccctgtc acggtcgagt ggaaagcaca gtccacatct gcacagaaca agatgttgag       720
     tggagttggg ggcttcgtgc tgggcctcct cttcctcgga gcggggctgt tcatctactt       780
     caggaaccag aaaggacagt ctggacttca gccaacagga ctcctgagct gagatgaagt       840
     aacaaggctg aaggaaggag ttcccccccg tgtctccatg ccatgaaaac atgtcctgct       900
     tggcccacat ccctccagag acactgctct tccaggacct ggctcctcct gattctccac       960
     cctggagatc tgtgctcctg atggctgctt atccctgacc caggccttgc agctcccaga      1020
     acagaggccc cactcttcac a                                                1041
//