spacer

EBI Dbfetch

ID   BC016929; SV 1; linear; mRNA; STD; HUM; 1341 BP.
XX
AC   BC016929;
XX
DT   14-NOV-2001 (Rel. 69, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 15)
XX
DE   Homo sapiens MHC class I polypeptide-related sequence A, mRNA (cDNA clone
DE   MGC:21250 IMAGE:4446575), complete cds.
XX
KW   MGC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1341
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1341
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (05-NOV-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; cc351b6ba277571ca1edac765faeb673.
DR   Ensembl-Gn; ENSG00000183214; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235233; homo_sapiens.
DR   Ensembl-Tr; ENST00000400325; homo_sapiens.
DR   Ensembl-Tr; ENST00000418465; homo_sapiens.
DR   Ensembl-Tr; ENST00000547609; homo_sapiens.
DR   EuropePMC; PMC2234200; 18230726.
DR   IMGT/LIGM; BC016929.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: ATCC
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 27 Row: p Column: 22
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 4557750.
CC   Differences found between this sequence and the human reference
CC   genome (build 36) are described in misc_difference features below
CC   and these differences were also compared to chimpanzee genomic
CC   sequences available as of 09/15/2004.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1341
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_89"
FT                   /clone="MGC:21250 IMAGE:4446575"
FT                   /tissue_type="Kidney, hypernephroma"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:9606"
FT   gene            1..1341
FT                   /gene="MICA"
FT                   /note="synonyms: PERB11.1, truncated"
FT   CDS             55..1206
FT                   /codon_start=1
FT                   /gene="MICA"
FT                   /product="MHC class I polypeptide-related sequence A"
FT                   /db_xref="GOA:Q29983"
FT                   /db_xref="H-InvDB:HIT000037754.18"
FT                   /db_xref="HGNC:HGNC:7090"
FT                   /db_xref="IMGT/HLA:MICA*018:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="PDB:1B3J"
FT                   /db_xref="PDB:1HYR"
FT                   /protein_id="AAH16929.1"
FT                   /translation="MGLGPVFLLLAGIFPFAPPGAAAEPHSLRYNLTVLSWDGSVQSGF
FT                   LTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIK
FT                   DQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETEEWTMPQSSRAQTLAM
FT                   NVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNIT
FT                   VTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFT
FT                   CYMEHSGNHSTHPVPSGKVLVLQSHWQTFHVSAVAAAAIFVIIIFYVRCCKKKTSAAEG
FT                   PELVSLQVLDQHPVGTSDHRDATQLGFQPLMSDLGSTGSTEGT"
FT   misc_difference 75
FT                   /gene="MICA"
FT                   /note="'C' in cDNA is 'T' in the human genome; no amino
FT                   acid change. The chimpanzee genome agrees with the cDNA
FT                   sequence, suggesting that this difference is unlikely to be
FT                   due to an artifact."
FT   misc_difference 192..193
FT                   /gene="MICA"
FT                   /note="in the human genome : TG. The chimpanzee genome
FT                   agrees with the cDNA sequence, suggesting that this
FT                   difference is unlikely to be due to an artifact."
FT   misc_difference 230
FT                   /gene="MICA"
FT                   /note="'G' in cDNA is 'A' in the human genome; amino acid
FT                   difference: 'C' in cDNA, 'Y' in the human genome. The
FT                   chimpanzee genome agrees with the cDNA sequence, suggesting
FT                   that this difference is unlikely to be due to an artifact."
FT   misc_difference 315
FT                   /gene="MICA"
FT                   /note="'A' in cDNA is 'G' in the human genome; no amino
FT                   acid change. The chimpanzee genome agrees with the cDNA
FT                   sequence, suggesting that this difference is unlikely to be
FT                   due to an artifact."
FT   misc_difference 508
FT                   /gene="MICA"
FT                   /note="'A' in cDNA is 'G' in the human genome; amino acid
FT                   difference: 'M' in cDNA, 'V' in the human genome. The
FT                   chimpanzee genome agrees with the cDNA sequence, suggesting
FT                   that this difference is unlikely to be due to an artifact."
FT   misc_difference 640
FT                   /gene="MICA"
FT                   /note="'A' in cDNA is 'G' in the human genome; amino acid
FT                   difference: 'K' in cDNA, 'E' in the human genome. The
FT                   chimpanzee genome agrees with the cDNA sequence, suggesting
FT                   that this difference is unlikely to be due to an artifact."
FT   misc_difference 717
FT                   /gene="MICA"
FT                   /note="'T' in cDNA is 'C' in the human genome; no amino
FT                   acid change. The chimpanzee genome agrees with the cDNA
FT                   sequence, suggesting that this difference is unlikely to be
FT                   due to an artifact."
FT   misc_difference 738..739
FT                   /gene="MICA"
FT                   /note="in the human genome : CA. The chimpanzee genome
FT                   agrees with the cDNA sequence, suggesting that this
FT                   difference is unlikely to be due to an artifact."
FT   misc_difference 751
FT                   /gene="MICA"
FT                   /note="'T' in cDNA is 'C' in the human genome; amino acid
FT                   difference: 'W' in cDNA, 'R' in the human genome. The
FT                   chimpanzee genome agrees with the cDNA sequence, suggesting
FT                   that this difference is unlikely to be due to an artifact."
FT   misc_difference 761
FT                   /gene="MICA"
FT                   /note="'C' in cDNA is 'T' in the human genome; amino acid
FT                   difference: 'T' in cDNA, 'I' in the human genome. The
FT                   chimpanzee genome agrees with the cDNA sequence, suggesting
FT                   that this difference is unlikely to be due to an artifact."
FT   misc_difference 767
FT                   /gene="MICA"
FT                   /note="'G' in cDNA is 'C' in the human genome; amino acid
FT                   difference: 'S' in cDNA, 'T' in the human genome. The
FT                   chimpanzee genome agrees with the cDNA sequence, suggesting
FT                   that this difference is unlikely to be due to an artifact."
FT   misc_difference 875
FT                   /gene="MICA"
FT                   /note="'A' in cDNA is 'G' in the human genome; amino acid
FT                   difference: 'Q' in cDNA, 'R' in the human genome. The
FT                   chimpanzee genome agrees with the cDNA sequence, suggesting
FT                   that this difference is unlikely to be due to an artifact."
FT   misc_difference 1006^1007
FT                   /gene="MICA"
FT                   /note="4 bases in the human genome, GCTG, are not found in
FT                   cDNA. The chimpanzee genome agrees with the cDNA sequence,
FT                   suggesting that this difference is unlikely to be due to an
FT                   artifact."
FT   misc_difference 1172
FT                   /gene="MICA"
FT                   /note="'A' in cDNA is 'C' in the human genome; amino acid
FT                   difference: 'D' in cDNA, 'A' in the human genome. The
FT                   chimpanzee genome agrees with the cDNA sequence, suggesting
FT                   that this difference is unlikely to be due to an artifact."
FT   misc_difference 1222
FT                   /gene="MICA"
FT                   /note="'A' in cDNA is 'G' in the human genome. The
FT                   chimpanzee genome agrees with the cDNA sequence, suggesting
FT                   that this difference is unlikely to be due to an artifact."
FT   misc_difference 1228
FT                   /gene="MICA"
FT                   /note="'G' in cDNA is 'A' in the human genome. The
FT                   chimpanzee genome agrees with the cDNA sequence, suggesting
FT                   that this difference is unlikely to be due to an artifact."
FT   misc_difference 1232
FT                   /gene="MICA"
FT                   /note="'C' in cDNA is 'G' in the human genome. The
FT                   chimpanzee genome agrees with the cDNA sequence, suggesting
FT                   that this difference is unlikely to be due to an artifact."
FT   misc_difference 1254
FT                   /gene="MICA"
FT                   /note="'G' in cDNA is 'A' in the human genome. The
FT                   chimpanzee genome agrees with the cDNA sequence, suggesting
FT                   that this difference is unlikely to be due to an artifact."
FT   misc_difference 1327..1341
FT                   /gene="MICA"
FT                   /note="polyA tail: 15 bases do not align to the human
FT                   genome."
XX
SQ   Sequence 1341 BP; 326 A; 354 C; 366 G; 295 T; 0 other;
     cgccttctcc ccggccactg cttgagccgc tgagagggtg gcgacgtcgg ggccatgggg        60
     ctgggcccgg tcttcctgct tctggctggc atcttccctt ttgcacctcc gggagctgct       120
     gctgagcccc acagtcttcg ttataacctc acggtgctgt cctgggatgg atctgtgcag       180
     tcagggtttc tcactgaggt acatctggat ggtcagccct tcctgcgctg tgacaggcag       240
     aaatgcaggg caaagcccca gggacagtgg gcagaagatg tcctgggaaa taagacatgg       300
     gacagagaga ccagagactt gacagggaac ggaaaggacc tcaggatgac cctggctcat       360
     atcaaggacc agaaagaagg cttgcattcc ctccaggaga ttagggtctg tgagatccat       420
     gaagacaaca gcaccaggag ctcccagcat ttctactacg atggggagct cttcctctcc       480
     caaaacctgg agactgagga atggacaatg ccccagtcct ccagagctca gaccttggcc       540
     atgaacgtca ggaatttctt gaaggaagat gccatgaaga ccaagacaca ctatcacgct       600
     atgcatgcag actgcctgca ggaactacgg cgatatctaa aatccggcgt agtcctgagg       660
     agaacagtgc cccccatggt gaatgtcacc cgcagcgagg cctcagaggg caacattacc       720
     gtgacatgca gggcttctgg cttctatccc tggaatatca cactgagctg gcgtcaggat       780
     ggggtatctt tgagccacga cacccagcag tggggggatg tcctgcctga tgggaatgga       840
     acctaccaga cctgggtggc caccaggatt tgccaaggag aggagcagag gttcacctgc       900
     tacatggaac acagcgggaa tcacagcact caccctgtgc cctctgggaa agtgctggtg       960
     cttcagagtc attggcagac attccatgtt tctgctgttg ctgctgctgc tatttttgtt      1020
     attattattt tctatgtccg ttgttgtaag aagaaaacat cagctgcaga gggtccagag      1080
     ctcgtgagcc tgcaggtcct ggatcaacac ccagttggga cgagtgacca cagggatgcc      1140
     acacagctcg gatttcagcc tctgatgtca gatcttgggt ccactggctc cactgagggc      1200
     acctagactc tacagccagg cagctgggat tcaattccct gcctggatct cacgagcact      1260
     ttccctcttg gtgcctcagt ttcctgacct atgaaacaga gaaaataaaa gcacttattt      1320
     attgttaaaa aaaaaaaaaa a                                                1341
//


spacer
spacer