spacer

EBI Dbfetch

ID   BC011080; SV 1; linear; mRNA; STD; MUS; 2581 BP.
XX
AC   BC011080;
XX
DT   31-JUL-2001 (Rel. 68, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 7)
XX
DE   Mus musculus aryl hydrocarbon receptor nuclear translocator-like, mRNA
DE   (cDNA clone MGC:18345 IMAGE:3661605), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2581
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2581
RA   Strausberg R.;
RT   ;
RL   Submitted (25-JUL-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; 1bda7a9c0d9e9291dba8adfbebba4bb4.
DR   Ensembl-Gn; ENSMUSG00000055116; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000047321; mus_musculus.
DR   EuropePMC; PMC2383916; 18430226.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Gilbert Smith, Ph.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 23 Row: f Column: 16
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 6680731.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2581
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="CZECH II"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Lu30"
FT                   /clone="MGC:18345 IMAGE:3661605"
FT                   /tissue_type="Mammary tumor metastatized to lung.
FT                   MMTV-LTR/Wnt1 model. Expression driven by an MMTV-LTR
FT                   enhancer."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..2581
FT                   /gene="Arntl"
FT                   /note="synonyms: MOP3, Arnt3, Bmal1"
FT   CDS             218..2059
FT                   /codon_start=1
FT                   /product="Arntl protein"
FT                   /db_xref="GOA:Q9WTL8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001067"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="MGI:MGI:1096381"
FT                   /db_xref="PDB:4F3L"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WTL8"
FT                   /protein_id="AAH11080.1"
FT                   /translation="MADQRMDISSTISDFMSPGPTDLLSGSLGTSGVDCNRKRKGSATD
FT                   YQLEYAEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRM
FT                   AVQHMKTLRGATNPYTEANYKPTFLSDDELKHLILRAADGFLFVVGCDRGKILFVSESV
FT                   FKILNYSQNDLIGQSLFDYLHPKDIAKVKEQLSSSDTAPRERLIDAKTGLPVKTDITPG
FT                   PSRLCSGARRSFFCRMKCNRPSVKVEDKDFASTCSKKKADRKSFCTIHSTGYLKSWPPT
FT                   KMGLDEDNEPDNEGCNLSCLVAIGRLHSHMVPQPANGEIRVKSMEYVSRHAIDGKFVFV
FT                   DQRATAILAYLPQELLGTSCYEYFHQDDIGHLAECHRQVLQTREKITTNCYKFKIKDGS
FT                   FITLRSRWFSFMNPWTKEVEYIVSTNTVVLANVLEGGDPTFPQLTAPPHSMDSMLPSGE
FT                   GGPKRTHPTVPGIPGGTRAGAGKIGRMIAEEIMEIHRIRGSSPSSCGSSPLNITSTPPP
FT                   DASSPGGKKILNGGTPDIPSTGLLPGQAQETPGYPYSDSSSILGENPHIGIDMIDNDQG
FT                   SSSPSNDEAAMAVIMSLLEADAGLGGPVDFSDLPWPL"
FT   misc_feature    398..556
FT                   /note="HLH; Region: Helix-loop-helix DNA-binding domain"
FT   misc_feature    623..811
FT                   /note="PAS; Region: PAS domain"
FT   misc_feature    1199..1360
FT                   /note="PAS; Region: PAS domain"
XX
SQ   Sequence 2581 BP; 725 A; 608 C; 616 G; 632 T; 0 other;
     cccacgcgtt cgagggaagg cagaaagtag gtcagggacg gaggtgcctg tttacccgcg        60
     ccggacttgc cgccgccgcc gccgcgggat ccgagtgcgg gtgcgggcgc gggcgctcgc       120
     agcgagccac ggtgttgttg gctgcagtga atgcttttgg aaccaaactt aaggcttcaa       180
     atgtggaacc ctaggccttc attgcacctt ccttccaatg gcggaccaga gaatggacat       240
     ttcctcaacc atcagcgact tcatgtctcc gggccccacc gacctactct ccggttccct       300
     gggcaccagt ggtgtggact gcaatcgcaa gaggaaaggc agtgccactg actaccagtt       360
     agaatatgca gaacaccaag gaaggatcaa gaatgcaagg gaggcccaca gtcagattga       420
     aaagaggcgt cgggacaaaa tgaacagttt cattgatgaa ttggcttctt tggtaccaac       480
     atgcaatgca atgtccagga agttagataa actcaccgtg ctaaggatgg ctgttcagca       540
     catgaaaact ttgagaggtg ccaccaaccc atacacagaa gcaaactaca agccaacatt       600
     tctatcagat gatgaactga aacacctaat tctcagggca gcagatggat ttttgtttgt       660
     cgtaggatgt gaccgaggga agatcctctt tgtctccgag tctgtcttca agatcctcaa       720
     ttatagccag aatgacctta ttggccagag cttgtttgac tacctgcatc caaaagatat       780
     tgccaaagtt aaggaacagc tatcttcctc ggacactgcg ccccgggagc gactcattga       840
     tgccaagact ggacttccgg ttaaaacgga tataacccct gggccctccc ggctatgctc       900
     tggagcccgc cgctctttct tctgtagaat gaagtgcaac aggccttcag taaaggtgga       960
     agataaggac ttcgcctcta cctgttcaaa gaaaaaagca gatcgaaaaa gcttctgcac      1020
     aatccacagc acaggctatt tgaaaagctg gccacccacg aagatggggc tggacgaaga      1080
     caatgagcca gacaacgagg gctgcaacct cagctgcctc gttgcaatcg ggcgcctgca      1140
     ctcgcacatg gttccacaac cagcgaacgg ggaaatacgg gtgaaatcta tggagtacgt      1200
     ttctcgacac gcaatagatg ggaaatttgt ttttgtagat cagagggcga cagctatttt      1260
     ggcgtatcta ccacaggaac ttctaggtac atcatgttat gagtattttc atcaagacga      1320
     cataggacac ctcgcagaat gtcacaggca agttttacag acaagagaaa agatcacgac      1380
     taattgctat aagtttaaga tcaaagatgg ttcttttatc acgctacgaa gtcgatggtt      1440
     cagtttcatg aacccgtgga ccaaggaagt tgaatacatt gtctcaacca acactgttgt      1500
     tttagccaat gtcctggaag gcggggaccc aaccttcccg cagctaacag caccccccca      1560
     cagcatggac agcatgctgc cctctggaga aggtggccca aagaggactc atcccactgt      1620
     cccaggcatt ccagggggaa ccagagccgg agcaggaaaa ataggtcgaa tgatcgccga      1680
     ggaaatcatg gaaatccaca ggataagagg gtcatcgcct tccagctgtg gctccagccc      1740
     gctgaacatc acaagtacgc ctccccctga tgcctcttct ccaggaggca agaagattct      1800
     aaatggaggg actccagaca ttccttccac tggactatta ccagggcagg ctcaggagac      1860
     cccagggtat ccctattctg atagttcttc tattcttggt gagaaccccc acataggcat      1920
     cgatatgata gataacgacc aaggatcaag tagtcccagt aacgatgagg cagcaatggc      1980
     tgtcatcatg agcctcttgg aagcagatgc ggggctgggt ggccccgttg actttagtga      2040
     cttgccatgg ccgctgtaga cactacattt tgctttggca acagctgcag tatcaaagtg      2100
     cattaatggt gaagttttac agtctgtgaa gcttactgga tagagagaga acagctttta      2160
     tgtactgact ccataaaagc cacctcagag ccattgatac aagtcaatct accatgtgta      2220
     acttcagaca aagtggaact aaacctgctc cagtgtttcc tcatcattga gtttgggcta      2280
     gctgtggata gcttgcatta attgtatatt ttggattttg tttgtgttga attttttaat      2340
     cattgtgcac agaagcatca ttggtagctt ttatatgcaa aatggtcatt tcagatgtat      2400
     ggtgttttta cactacaaag aagtccccca tgtggatatt tcttatacta attgtatcat      2460
     aaagctgttt attcttcctt gtaagaatcc tttactataa atatgggtta aagtataatg      2520
     tattagacag ttaaatattt ttaataaatg tttcccttgt tctataaaaa aaaaaaaaaa      2580
     a                                                                      2581
//


spacer
spacer