spacer

EBI Dbfetch

ID   AY988108; SV 1; linear; genomic DNA; STD; HUM; 1296 BP.
XX
AC   AY988108;
XX
DT   23-NOV-2005 (Rel. 85, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*new allele, exons 1
DE   through 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1296
RX   DOI; 10.1111/j.1399-0039.2005.00490.x.
RX   PUBMED; 16305687.
RA   Thude H., Hardt C., Schorner U., Ferencik S., Helfricht C., Barz D.;
RT   "Identification of a new HLA-B allele, HLA-B*4443, in a German family";
RL   Tissue Antigens 66(6):696-699(2005).
XX
RN   [2]
RP   1-1296
RA   Thude H., Ferencik S., Hardt C.;
RT   "A new HLA-B allele with sequence similarity to the HLA-B*4417 allele";
RL   Unpublished.
XX
RN   [3]
RP   1-1296
RA   Hardt C., Ferencik S., Thude H.;
RT   ;
RL   Submitted (29-MAR-2005) to the INSDC.
RL   University Hospital of Essen, Institute of Immunology, Hufelandstr. 55,
RL   Essen 45122, Germany
XX
DR   MD5; 35ced5fb62be70dd42f0ab9a18328c23.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1296
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.31"
FT                   /mol_type="genomic DNA"
FT                   /note="ethnic origin Caucasoid"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1296
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*new"
FT   mRNA            join(<1..67,197..466,710..>985)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*new"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..67,197..466,710..>985)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presentation"
FT                   /note="major histocompatibility class I antigen; human
FT                   leukocyte antigen B"
FT                   /db_xref="GOA:Q2YDY9"
FT                   /db_xref="IMGT/HLA:B*44:43:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YDY9"
FT                   /protein_id="AAY43935.1"
FT                   /translation="VTAPRTLLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPRFI
FT                   TVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRENLRTAL
FT                   RYYNQSEAGSHIIQRMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQ
FT                   ITQRKWEAARVAEQLRAYLEGLCVESLRRYLENGKETLQRA"
FT   exon            <1..67
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*new"
FT                   /number=1
FT   exon            197..466
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*new"
FT                   /number=2
FT   exon            710..985
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*new"
FT                   /number=3
XX
SQ   Sequence 1296 BP; 232 A; 413 C; 454 G; 197 T; 0 other;
     gtcacggcgc cccgaaccct cctcctgctg ctctgggggg cagtggccct gaccgagacc        60
     tgggccggtg agtgcggggt cgggagggaa atggcctctg tggggaggag agaggggacc       120
     gcaggcgggg gcgcaggacc cggggagccg cgccgggagg agggtcgggc gggtctcagc       180
     ccctcctcgc ccccaggctc ccactccatg aggtatttct acaccgccat gtcccggccc       240
     ggccgcgggg agccccgctt catcaccgtg ggctacgtgg acgacacgct gttcgtgagg       300
     ttcgacagcg acgccacgag tccgaggaag gagccgcggg cgccatggat agagcaggag       360
     gggccggagt attgggaccg ggagacacag atctccaaga ccaacacaca gacttaccga       420
     gagaacctgc gcaccgcgct ccgctactac aaccagagcg aggccggtga gtgaccccgg       480
     cccggggcgc aggtcacgac tccccatccc ccacgtacgg cccgggtcgc cccgagtctc       540
     cgggtccgag atccgccccc gaggccgcgg gacccgccca gaccctcgac cggcgagagc       600
     cccaggcgcg tttacccggt ttcattttca gttgaggcca aaatccccgc gggttggtcg       660
     gggcggggcg gggctcgggg gacggggctg accgcggggc cggggccagg gtctcacatc       720
     atccagagga tgtacggctg cgacgtgggg ccggacgggc gcctcctccg cgggcatgac       780
     cagtccgcct acgacggcaa ggattacatc gccctgaacg aggacctgag ctcctggacc       840
     gcggcggaca ccgcggctca gatcacccag cgcaagtggg aggcggcccg tgtggcggag       900
     cagctgagag cctacctgga gggcctgtgc gtggagtcgc tccgcagata cctggagaac       960
     gggaaggaga cgctgcagcg cgcgggtacc aggggcagtg gggagccttc cccatctcct      1020
     ataggtcgcc ggggatggcc tcccacgaga agaggaggaa aatgggatca gcgctagaat      1080
     gtcgccctcc cttgaatgga gaatggcatg agttttcctg agtttcctct gagggccccc      1140
     tcttctctct aggacaatta agggatgacg tctctgagga aatggagggg aagacagtcc      1200
     ctagaatact gatcaggggt cccctttgac ccctgcagca gccttgggaa ccgtgacttt      1260
     tcctctcagg ccttgttctc tgcctcacac tcagtg                                1296
//


spacer
spacer