Dbfetch

ID   AY973961; SV 1; linear; genomic DNA; STD; HUM; 3320 BP.
XX
AC   AY973961;
XX
DT   25-APR-2005 (Rel. 83, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-C) gene, HLA-Cw*02ne allele, complete
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3320
RA   Vicario J.L., Alonso-Nieto M.;
RT   "Eight new HLA class I alleles";
RL   Unpublished.
XX
RN   [2]
RP   1-3320
RA   Vicario J.L., Alonso-Nieto M.;
RT   ;
RL   Submitted (25-MAR-2005) to the INSDC.
RL   Histocompatibility, Regional Transfusion Centre, Av. de la Democracia s/n,
RL   Madrid 28032, Spain
XX
DR   MD5; 86a83cd46a667da7f75c104e6964997a.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3320
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <257..>3149
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*02ne"
FT   mRNA            join(<257..329,460..729,975..1250,1838..2113,2235..2354,
FT                   2794..2826,2934..2981,3145..>3149)
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*02ne"
FT                   /product="MHC class I antigen"
FT   CDS             join(257..329,460..729,975..1250,1838..2113,2235..2354,
FT                   2794..2826,2934..2981,3145..3149)
FT                   /codon_start=1
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*02ne"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q52QV2"
FT                   /db_xref="IMGT/HLA:C*02:11"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q52QV2"
FT                   /protein_id="AAX94770.1"
FT                   /translation="MRVMAPRTLLLLLSGALALTETWACSHSMRYFYTAVSRPSRGEPH
FT                   FIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVNLRK
FT                   LRGYYNQSEAGSHTLQRMYGCDLGPDGRLLRGYDQSAYDGKDYIAQNEDLRSWTAADTA
FT                   AQITQRKWEAAREAEQWRAYLEGECVEWLRRYLENGKETLQRAEHPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPTEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPEPLTLRWEPSSQPTIPIVGIVAGLAVLAVLAVLGAVVAVVMCRRKSSGG
FT                   KGGSCSQAASSNSAQGSDESLIACKA"
FT   exon            <257..329
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*02ne"
FT                   /number=1
FT   exon            460..729
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*02ne"
FT                   /number=2
FT   exon            975..1250
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*02ne"
FT                   /number=3
FT   exon            1838..2113
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*02ne"
FT                   /number=4
FT   exon            2235..2354
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*02ne"
FT                   /number=5
FT   exon            2794..2826
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*02ne"
FT                   /number=6
FT   exon            2934..2981
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*02ne"
FT                   /number=7
FT   exon            3145..>3149
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*02ne"
FT                   /number=8
XX
SQ   Sequence 3320 BP; 625 A; 975 C; 1029 G; 691 T; 0 other;
     cggggctctc agggtctcag gctccaaggg ccgtgtctgc actggggagg cgccgcgttg        60
     aggattctcc actcccctga gtttcacttc ttctcccaac ctgcgacggg tccttcttcc       120
     tgaatactca tgacgcgtcc ccaattccca ctcccattgg gtgtcgggtt ctagagaagc       180
     caatcagcgt ctccgcagtc ccggttctaa agtccccagt cacccacccg gactcggatt       240
     ctccccagac gccgagatgc gggtcatggc gccccgaacc ctcctcctgc tgctctcggg       300
     agccctggcc ctgaccgaga cctgggcctg tgagtgcggg gttgggaggg aaacggcctc       360
     tgcggagagg agcgaggggc ccgcccggcg agggcgcagg acccggggag ccgcgcaggg       420
     aggagggtcg ggcgggtctc agcccctcct ctcccccagg ctcccactcc atgaggtatt       480
     tctacaccgc tgtgtcccgg cccagccgcg gagagcccca cttcatcgca gtgggctacg       540
     tggacgacac gcagttcgtg cggttcgaca gcgacgccgc gagtccaaga ggggagccgc       600
     gggcgccgtg ggtggagcag gaggggccgg agtattggga ccgggagaca cagaagtaca       660
     agcgccaggc acagactgac cgagtgaacc tgcggaaact gcgcggctac tacaaccaga       720
     gcgaggccgg tgagtgaccc cggcccgggg cgcaggtcac gacccctccc catcccccac       780
     ggacggcccg ggtcgccccg agtctccggg tctgagatcc accccgaggc tgcggaaccc       840
     gcccagaccc tcgaccggag agagccccag tcacctttac ccggtttcat tttcagttta       900
     ggccaaaatc cccgcgggtt ggtcggggct ggggcggggc tcgggggacg ggctgaccac       960
     gggggcgggg ccagggtctc acaccctcca gaggatgtac ggctgcgacc tggggcccga      1020
     cgggcgcctc ctccgcgggt atgaccagtc cgcctacgac ggcaaggatt acatcgccca      1080
     gaacgaggac ctgcgctcct ggaccgccgc ggacacagcg gctcagatca cccagcgcaa      1140
     gtgggaggcg gcccgtgagg cggagcagtg gagagcctac ctggagggcg agtgcgtgga      1200
     gtggctccgc agatacctgg agaacgggaa ggagacgctg cagcgcgcgg gtaccagggg      1260
     cagtggggag ccttccccat ctcctgtaga tctcccggga tggcctccca cgaggagggg      1320
     aggaaaatgg gatcagcgct agaatatcgc cctcccttga atggagaatg ggatgagttt      1380
     tcctgagttt cctctgaggg ccccctctgc tctctaggac aattaaggga tgaagtcctt      1440
     gaggaaatgg aggggaagac agtccctgga atactgatca ggggtcccct ttgaccactt      1500
     tgaccactgc agcagctgtg gtcaggctgc tgacctttct ctcaggcctt gttctctgcc      1560
     tcacgctcaa tgtgtttgaa ggtttgattc cagcttttct gagtccttcg gcctccactc      1620
     aggtcaggac cagaagtcgc tgttcctccc tcagagacta gaactttcca atgaatagga      1680
     gattatccca ggtgcctgtg tccaggctgg cgtctgggtt ctgtgccccc ttccccaccc      1740
     caggtgtcct gtccattctc aggatagtca catgggcgct gttggagtgt cgcaagagag      1800
     atacaaagtg tctgaatttt ctgactcttc ccgtcagaac acccaaagac acacgtgacc      1860
     caccatcccg tctctgacca tgaggccacc ctgaggtgct gggccctggg cttctaccct      1920
     acggagatca cactgacctg gcagcgggat ggcgaggacc aaactcagga caccgagctt      1980
     gtggagacca ggccagcagg agatggaacc ttccagaagt gggcagctgt ggtggtgcct      2040
     tctggagaag agcagagata cacgtgccat gtgcagcacg aggggctgcc ggagcccctc      2100
     accctgagat ggggtaagga gggggatgag gggtcatgtg tcttctcagg gaaagcagaa      2160
     gtcctggagc ccttcagctg ggtcagggct gaggcttggg ggtcagggcc cctcaccttc      2220
     ccctcctttc ccagagccat cttcccagcc caccatcccc atcgtgggca tcgttgctgg      2280
     cctggctgtc ctggctgtcc tagctgtcct aggagctgtg gtggctgttg tgatgtgtag      2340
     gaggaagagc tcaggtaggg aaggggtgag gagtggggtc tgggttttct tgtcccactg      2400
     ggagtttcaa gccccaggta gaagtgtgcc ccacctcgtt actggaagca ccatccacac      2460
     atgggccatc ccagcctggg accctgtgtg ccagcactta ctctgttgtg aagcacatga      2520
     caatgaagga cagatgtatc accttgatga ttatggtgtt ggggtccttg attccagcat      2580
     tcatgagtca ggggaaggtc cctgctaagg acagacctta ggagggcagt tgctccagaa      2640
     cccacagctg ctttccccgt gtttcctgat cctgccctgg gtctgcagtc atagttctgg      2700
     aaacttctct tgggtccaag actaggaggt tcccctaaga ttgcatggcc ctgcctcctc      2760
     cctgtcccct cacagggcat tttcttccca caggtggaaa aggagggagc tgctctcagg      2820
     ctgcgtgtaa gtgatggcgg caggcgtgtg gaggagctca cccaccccat aattcctctt      2880
     gtcccacatc tcctgcgggc tctgaccagg tctttttttt tgttctaccc cagccagcaa      2940
     cagtgcccag ggctctgatg agtctctcat cgcttgtaaa ggtgagattc tgggagctga      3000
     agtggtcggg ggtggggcag agggaaaagg cctaggtaat ggggatcctt tgatagggac      3060
     gtttcgaatg tgtggtgagc tgttcagagt gtcatcactt accatgactg acctgaattt      3120
     gttcatgact attgtgttct gtagcctgag acagctgcct gtgtgggact gagatgcagg      3180
     atttcttcac acctctcctt tgtgacttca agagcctctg gcatctcttt ctacaaaggc      3240
     atctgaatgt gtctgcgttc ctgttagcat aatgtgagga ggtggagaga cagcccaccc      3300
     ccgtgtccac cgtgacccct                                                  3320
//