spacer

EBI Dbfetch

ID   AY973960; SV 1; linear; genomic DNA; STD; HUM; 3322 BP.
XX
AC   AY973960;
XX
DT   25-APR-2005 (Rel. 83, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-C) gene, HLA-Cw*0509 allele, complete
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3322
RA   Vicario J.L., Alonso-Nieto M.;
RT   "Eight new HLA class I alleles";
RL   Unpublished.
XX
RN   [2]
RP   1-3322
RA   Vicario J.L., Alonso-Nieto M.;
RT   ;
RL   Submitted (25-MAR-2005) to the INSDC.
RL   Histocompatibility, Regional Transfusion Centre, Av. de la Democracia s/n,
RL   Madrid 28032, Spain
XX
DR   MD5; bb8835a101a1bd226ba1cf04e30c8298.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3322
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <257..>3151
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*0509"
FT   mRNA            join(<257..329,460..729,976..1251,1839..2114,2236..2355,
FT                   2795..2827,2935..2982,3147..>3151)
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*0509"
FT                   /product="MHC class I antigen"
FT   CDS             join(257..329,460..729,976..1251,1839..2114,2236..2355,
FT                   2795..2827,2935..2982,3147..3151)
FT                   /codon_start=1
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*0509"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q52QV3"
FT                   /db_xref="IMGT/HLA:C*05:09:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q52QV3"
FT                   /protein_id="AAX94769.1"
FT                   /translation="MRVMAPRTLILLLSGALALTETWACSHSMRYFYTAVSRPGRGEPR
FT                   FIAVGYVDDTQFVQFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVNLRK
FT                   LRGYYNQSEAGSHTLQRMYGCDLGPDGRLLRGYNQFAYDGKDYIALNEDLRSWTAADKA
FT                   AQITQRKWEAAREAEQRRAYLEGTCVEWLRRYLENGKETLQRAEHPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPEPLTLRWGPSSQPTIPIVGIVAGLAVLAVLAVLGAVMAVVMCRRKSSGG
FT                   KGGSCSQAASSNSAQGSDESLIACKA"
FT   exon            <257..329
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*0509"
FT                   /number=1
FT   exon            460..729
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*0509"
FT                   /number=2
FT   exon            976..1251
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*0509"
FT                   /number=3
FT   exon            1839..2114
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*0509"
FT                   /number=4
FT   exon            2236..2355
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*0509"
FT                   /number=5
FT   exon            2795..2827
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*0509"
FT                   /number=6
FT   exon            2935..2982
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*0509"
FT                   /number=7
FT   exon            3147..>3151
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*0509"
FT                   /number=8
XX
SQ   Sequence 3322 BP; 622 A; 971 C; 1032 G; 697 T; 0 other;
     cggggctctc agggtctcag gctccaaggg ccgtgtctgc actggggagg cgccgcgttg        60
     aggattctcc actcccctga gtttcacttc ttcttccaac ctgcgtcggg tccttcttcc       120
     tgaatactca tgacgcgtcc ccaattccca ctcccattgg gtgtcgggtt ctagagaagc       180
     caatcagcgt ctccgcagtc ccggttctaa agtccccagt cacccacccg gactcggatt       240
     ctccccagac gccgagatgc gggtcatggc gccccgaacc ctcatcctgc tgctctcggg       300
     agccctggcc ctgaccgaga cctgggcctg tgagtgcgag gttgggaggg aaacggcctc       360
     tgcggagagg agcgaggggc ccgcccggcg agggcgcagg acccggggag ccgcgcaggg       420
     aggagggtcg ggcgggtctc agcccctcct cgcccccagg ctcccactcc atgaggtatt       480
     tctacaccgc cgtgtcccgg cccggccgcg gagagccccg cttcatcgca gtgggctacg       540
     tggacgacac gcagttcgtg cagttcgaca gcgacgccgc gagtccaaga ggggagccgc       600
     gggcgccgtg ggtggagcag gaggggccgg agtattggga ccgggagaca cagaagtaca       660
     agcgccaggc acagactgac cgagtgaacc tgcggaaact gcgcggctac tacaaccaga       720
     gcgaggccgg tgagtgaccc cggcccgggg cgcaggtcac gacccctccc catcccccac       780
     ggacggcccg ggtcgccccg agtctcccgg tctgagatcc accccgaggc tgcggaaccc       840
     gcccagaccc tcgaccggag agagccccag tcacctttac ccggtttcat tttcagttta       900
     ggccaaaatc cccgcgggtt ggtcggggct ggggcggggc tcgggggacg gggctgacca       960
     cgggggcggg gccagggtct cacaccctcc agaggatgta tggctgcgac ctggggcccg      1020
     acgggcgcct cctccgcggg tataaccagt tcgcctacga cggcaaggat tacatcgccc      1080
     tgaatgagga cctgcgctcc tggaccgccg cggacaaggc ggctcagatc acccagcgca      1140
     agtgggaggc ggcccgtgag gcggagcagc ggagagccta cctggagggc acgtgcgtgg      1200
     agtggctccg cagatacctg gagaacggga aggagacgct gcagcgcgcg ggtaccaggg      1260
     gcagtgggga gccttcccca tctcctgtag atctcccggg atggcctccc acgaggaggg      1320
     gaggaaaatg ggatcagcgc tggaatatcg ccctcccttg aatggagaat gggatgagtt      1380
     ttcctgagtt tcttctgagg gccccctctg ctctctagga caattaaggg atgaagtcct      1440
     tgaggaaatg gaggggaaga cagtccctgg aatactgatc aggggtcccc tttgaccact      1500
     ttgaccactg cagcagctgt ggtcaggctg ctgacctttc tctcaggcct tgttctctgc      1560
     ctcacgctca atgtgtttaa aggtttgatt ccagcttttc tgagtccttc ggcctccact      1620
     caggtcagga ccagaagtcg ctgttcctcc ctcagagact agaactttcc aatgaatagg      1680
     agattatccc aggtgcctgt gtccaggctg gcgtctgggt tctgtgcccc cttccccacc      1740
     ccaggtgtcc tgtccattct caggatggtc acatgggcac tgttggagtg tcgcaagaga      1800
     gatacaaagt gtctgaattt tctgactctt cccgtcagaa cacccaaaga cacacgtgac      1860
     ccaccatccc gtctctgacc atgaggccac cctgaggtgc tgggccctgg gcttctaccc      1920
     tgcggagatc acactgacct ggcagcggga tggcgaggac caaactcagg acaccgagct      1980
     tgtggagacc aggccagcag gagatggaac cttccagaag tgggcagctg tggtggtgcc      2040
     ttctggagaa gagcagagat acacgtgcca tgtgcagcac gaggggctgc cagagcccct      2100
     caccctgaga tggggtaagg agggggatga ggggtcatgt gtcttctcag ggaaagcaga      2160
     agtcctggag cccttcagcc gggtcagggc tgaggcttgg gggtcagggc ccctcacctt      2220
     cccctccttt cccagggcca tcttcccagc ccaccatccc catcgtgggc atcgttgctg      2280
     gcctggctgt cctggctgtc ctagctgtcc taggagctgt gatggctgtt gtgatgtgta      2340
     ggaggaagag ctcaggtagg gaaggggtga ggagtggggt ctgggttttc ttgtcccact      2400
     gggagtttca agccccaggt agaagtgtgc cccacctcgt tactggaagc accatccaca      2460
     catgggccat cccagcctgg gaccctgtgt gctagcactt actctgttgt gaagcacatg      2520
     acaatgaagg acagatgtat caccttgatg attatggtgt tggggtcctt gattccagca      2580
     ttcatgagtc aggggaaggt ccctgctaag gacagacctt aggagggcag ttgctccaga      2640
     acccacagct gctttccccg tgtttcctga tcctgccctg ggtctgcagt catagttctg      2700
     gaaacttctc ttgggtccaa gactaggagg ttcccctaag atcgcatggc cctgcctcct      2760
     ccctgtcccc tcacagggca ttttcttccc acaggtggaa aaggagggag ctgctctcag      2820
     gctgcgtgta agtgatggcg gtgggcgtgt ggaggagctc acccacccca taattcctct      2880
     tgtcccacat ctcctgcggg ctctgaccag gtcttttttt ttgttctacc ccagccagca      2940
     acagtgccca gggctctgat gagtctctca tcgcttgtaa aggtgagatt ctggggagct      3000
     gaagtggtcg ggggtggggc agagggaaaa ggcctaggta atggggatcc tttgattggg      3060
     acgtttcgaa tgtgtggtga gctgttcaga gtgtcatcac ttaccatgac tgacctgaat      3120
     ttgttcatga ctattgtgtt ctgtagcctg agacagctgc ctgtgtggga ctgagatgca      3180
     ggatttcttc acacctttcc tttgtgactt caagagcctc tggcatctct ttctgcaaag      3240
     gcatctgaat gtgtctgcgt tcctgttagc ataatgtgag gaggtggaga gacagcccac      3300
     ccccgtgtcc accgtgaccc ct                                               3322
//


spacer
spacer