spacer

EBI Dbfetch

ID   AY973959; SV 1; linear; genomic DNA; STD; HUM; 3291 BP.
XX
AC   AY973959;
XX
DT   25-APR-2005 (Rel. 83, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*01ne allele, complete
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3291
RA   Vicario J.L., Alonso-Nieto M.;
RT   "Eight new HLA class I alleles";
RL   Unpublished.
XX
RN   [2]
RP   1-3291
RA   Vicario J.L., Alonso-Nieto M.;
RT   ;
RL   Submitted (25-MAR-2005) to the INSDC.
RL   Histocompatibility, Regional Transfusion Centre, Av. de la Democracia s/n,
RL   Madrid 28032, Spain
XX
DR   MD5; 743d9f66c77fc21b964a681e0c6de2ad.
DR   Ensembl-Gn; ENSG00000224320; homo_sapiens.
DR   Ensembl-Gn; ENSG00000229215; homo_sapiens.
DR   Ensembl-Gn; ENSG00000265434; homo_sapiens.
DR   Ensembl-Tr; ENST00000431930; homo_sapiens.
DR   Ensembl-Tr; ENST00000443552; homo_sapiens.
DR   Ensembl-Tr; ENST00000549869; homo_sapiens.
DR   Ensembl-Tr; ENST00000552193; homo_sapiens.
DR   Ensembl-Tr; ENST00000583265; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3291
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <222..>3120
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*01ne"
FT   mRNA            join(<222..294,425..694,932..1207,1787..2062,2165..2281,
FT                   2724..2756,2899..2946,3116..>3120)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*01ne"
FT                   /product="MHC class I antigen"
FT   CDS             join(222..294,425..694,932..1207,1787..2062,2165..2281,
FT                   2724..2756,2899..2946,3116..3120)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*01ne"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q5SUL5"
FT                   /db_xref="IMGT/HLA:A*01:01:01:02N"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SUL5"
FT                   /protein_id="AAX94768.1"
FT                   /translation="MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQKMEPRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGT
FT                   LRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITKRKWEAVHAAEQRRVYLEGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRK
FT                   GGSYTQAASSDSAQGSDVSLTACKV"
FT   exon            <222..294
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*01ne"
FT                   /number=1
FT   exon            425..694
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*01ne"
FT                   /number=2
FT   exon            932..1207
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*01ne"
FT                   /number=3
FT   exon            1787..2062
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*01ne"
FT                   /number=4
FT   exon            2165..2281
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*01ne"
FT                   /number=5
FT   exon            2724..2756
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*01ne"
FT                   /number=6
FT   exon            2899..2946
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*01ne"
FT                   /number=7
FT   exon            3116..>3120
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*01ne"
FT                   /number=8
XX
SQ   Sequence 3291 BP; 629 A; 949 C; 1011 G; 702 T; 0 other;
     gattggggag tcccagcctt ggggattccc caactccgca gtttcttttc tccctctccc        60
     aacctacgta gggtccttca tcctggatac tcacgacgcg gacccagttc tcactcccat       120
     tgggtgtcgg gtttccagag aagccaatca gtgtcgtcgc ggtcgctgtt ctaaagtccg       180
     cacgcaccca ccgggactca gattctcccc agacgccgag gatggccgtc atggcgcccc       240
     gaaccctcct cctgctactc tcgggggccc tggccctgac ccagacctgg gcgggtgagt       300
     gcggggtcgg gagggaaacc gcctctgcgg ggagaagcaa ggggccctcc tggcgggggc       360
     gcaggaccgg gggagccgcg ccgggaggag ggtcgggcag gtctcagcca ctgctcgccc       420
     ccaggctccc actccatgag gtatttcttc acatccgtgt cccggcccgg ccgcggggag       480
     ccccgcttca tcgccgtggg ctacgtggac gacacgcagt tcgtgcggtt cgacagcgac       540
     gccgcgagcc agaagatgga gccgcgggcg ccgtggatag agcaggaggg gccggagtat       600
     tgggaccagg agacacggaa tatgaaggcc cactcacaga ctgaccgagc gaacctgggg       660
     accctgcgcg gctactacaa ccagagcgag gacggtgacc ccggcccggg gcgcaggtca       720
     cgacccctca tcccccacgg acgggccagg tcgcccacag tctccgggtc cgagatccac       780
     cccgaagccg cgggactccg agacccttgt cccgggagag gcccaggcgc ctttacccgg       840
     tttcattttc agtttaggcc aaaaatcccc ccgggttggt cggggcgggg cggggctcgg       900
     gggactgggc tgaccgcggg gtcggggcca ggttctcaca ccatccagat aatgtatggc       960
     tgcgacgtgg ggccggacgg gcgcttcctc cgcgggtacc ggcaggacgc ctacgacggc      1020
     aaggattaca tcgccctgaa cgaggacctg cgctcttgga ccgcggcgga catggcagct      1080
     cagatcacca agcgcaagtg ggaggcggtc catgcggcgg agcagcggag agtctacctg      1140
     gagggccggt gcgtggacgg gctccgcaga tacctggaga acgggaagga gacgctgcag      1200
     cgcacgggta ccaggggcca cggggcgcct ccctgatcgc ctatagatct cccgggctgg      1260
     cctcccacaa ggaggggaga caattgggac caacactaga atatcaccct ccctctggtc      1320
     ctgagggaga ggaatcctcc tgggtttcca gatcctgtac cagagagtga ctctgaggtt      1380
     ccgccctgct ctctgacaca attaagggat aaaatctctg aaggagtgac gggaagacga      1440
     tccctcgaat actgatgagt ggttcccttt gacaccggca gcagccttgg gcccgtgact      1500
     tttcctctca ggccttgttc tctgcttcac actcaatgtg tgtgggggtc tgagtccagc      1560
     acttctgagt ctctcagcct ccactcaggt caggaccaga agtcgctgtt cccttctcag      1620
     ggaatagaag attatcccag gtgcctgtgt ccaggctggt gtctgggttc tgtgctctct      1680
     tccccatccc gggtgtcctg tccattctca agatggccac atgcgtgctg gtggagtgtc      1740
     ccatgacaga tgcaaaatgc ctgaattttc tgactcttcc cgtcagaccc ccccaagaca      1800
     catatgaccc accaccccat ctctgaccat gaggccaccc tgaggtgctg ggccctgggc      1860
     ttctaccctg cggagatcac actgacctgg cagcgggatg gggaggacca gacccaggac      1920
     acggagctcg tggagaccag gcctgcaggg gatggaacct tccagaagtg ggcggctgtg      1980
     gtggtgcctt ctggagagga gcagagatac acctgccatg tgcagcatga gggtctgccc      2040
     aagcccctca ccctgagatg gggtaaggag ggagatgggg gtgtcatgtc tcttagggaa      2100
     agcaggagcc tctctggaga cctttagcag ggtcagggcc cctcaccttc ccctcttttc      2160
     ccagagctgt cttcccagcc caccatcccc atcgtgggca tcattgctgg cctggttctc      2220
     cttggagctg tgatcactgg agctgtggtc gctgccgtga tgtggaggag gaagagctca      2280
     ggtggagaag gggtgaaggg tggggtctga gatttcttgt ctcactgagg gttccaagcc      2340
     ccagctagaa atgtgccctg tctcattact gggaagcacc ttccacaatc atgggccgac      2400
     ccagcctggg ccctgtgtgc cagcacttac tcttttgtaa agcacctgtt aaaatgaagg      2460
     acagatttat caccttgatt acggcggtga tgggacctga tcccagcagt cacaagtcac      2520
     aggggaaggt ccctgaggac agacctcagg agggctattg gtccaggacc cacacctgct      2580
     ttcttcatgt ttcctgatcc cgccctgggt ctgcagtcac acatttctgg aaacttctct      2640
     ggggtccaag actaggaggt tcctctagga ccttaaggcc ctggctcctt tctggtatct      2700
     cacaggacat tttcttccca cagatagaaa aggagggagt tacactcagg ctgcaagtaa      2760
     gtatgaagga ggctgatgcc tgaggtcctt gggatattgt gtttgggagc ccatggggga      2820
     gctcacccac cccacaattc ctcctctagc cacatcttct gtgggatctg accaggttct      2880
     gtttttgttc taccccaggc agtgacagtg cccagggctc tgatgtgtct ctcacagctt      2940
     gtaaaggtga gagcttggag ggcctgatgt gtgttgggtg ttgggtggaa cagtggacac      3000
     agctgtgcta tggggtttct ttgcgttgga tgtattgagc atgcgatggg ctgtttaagg      3060
     tgtgacccct cactgtgatg gatatgaatt tgttcatgaa tatttttttc tatagtgtga      3120
     gacagctgcc ttgtgtggga ctgagaggca agagttgttc ctgcccttcc ctttgtgact      3180
     tgaagaaccc tgactttgtt tctgcaaagg cacctgcatg tgtctgtgtt cgtgtaggca      3240
     taatgtgagg aggtggggag agcaccccac ccccatgtcc accatgaccc t               3291
//


spacer
spacer