spacer

EBI Dbfetch

ID   AY973958; SV 1; linear; genomic DNA; STD; HUM; 3309 BP.
XX
AC   AY973958;
XX
DT   25-APR-2005 (Rel. 83, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*02v allele, complete
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3309
RA   Vicario J.L., Alonso-Nieto M.;
RT   "Eight new HLA class I alleles";
RL   Unpublished.
XX
RN   [2]
RP   1-3309
RA   Vicario J.L., Alonso-Nieto M.;
RT   ;
RL   Submitted (25-MAR-2005) to the INSDC.
RL   Histocompatibility, Regional Transfusion Centre, Av. de la Democracia s/n,
RL   Madrid 28032, Spain
XX
DR   MD5; 2cbf6e9f368ea4387632204bbdcba76f.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3309
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <222..>3138
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02v"
FT   mRNA            join(<222..294,425..694,936..1211,1812..2087,2187..2303,
FT                   2742..2774,2917..2964,3134..>3138)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02v"
FT                   /product="MHC class I antigen"
FT   CDS             join(222..294,425..694,936..1211,1812..2087,2187..2303,
FT                   2742..2774,2917..2964,3134..3138)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02v"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q52QV5"
FT                   /db_xref="IMGT/HLA:A*02:81"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q52QV5"
FT                   /protein_id="AAX94767.1"
FT                   /translation="MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTDRESLRI
FT                   ALRYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMA
FT                   AQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVITGAVVAAVMWRRKSSDRK
FT                   GGSYSQAASSDSAQGSDVSLTACKV"
FT   exon            <222..294
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02v"
FT                   /number=1
FT   exon            425..694
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02v"
FT                   /number=2
FT   exon            936..1211
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02v"
FT                   /number=3
FT   exon            1812..2087
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02v"
FT                   /number=4
FT   exon            2187..2303
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02v"
FT                   /number=5
FT   exon            2742..2774
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02v"
FT                   /number=6
FT   exon            2917..2964
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02v"
FT                   /number=7
FT   exon            3134..>3138
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02v"
FT                   /number=8
XX
SQ   Sequence 3309 BP; 640 A; 950 C; 1008 G; 711 T; 0 other;
     gattggggag tcccagcctt ggggattccc caactccgca gtttcttttc tccctctccc        60
     aacctatgta gggtccttct tcctggatac tcacgacgcg gacccagttc tcactcccat       120
     tgggtgtcgg gtttccagag aagccaatca gtgtcgtcgc ggtcgcggtt ctaaagtccg       180
     cacgcaccca ccgggactca gattctcccc agacgccgag gatggccgtc atggcgcccc       240
     gaaccctcgt cctgctactc tcgggggctc tggccctgac ccagacctgg gcgggtgagt       300
     gcggggtcgg gagggaaacg gcctctgtgg ggagaagcaa cgggcccgcc tggcgggggc       360
     gcaggacccg ggaagccgcg ccgggaggag ggtcgggcgg gtctcagcca ctcctcgtcc       420
     ccaggctctc actccatgag gtatttcttc acatccgtgt cccggcccgg ccgcggggag       480
     ccccgcttca tcgcagtggg ctacgtggac gacacgcagt tcgtgcggtt cgacagcgac       540
     gccgcgagcc agaggatgga gccgcgggcg ccgtggatag agcaggaggg tccggagtat       600
     tgggacgggg agacacggaa agtgaaggcc cactcacaga ctgaccgaga gagcctgcgg       660
     atcgcgctcc gctactacaa ccagagcgag gccggtgagt gaccccggcc cggggcgcag       720
     gtcacgacct ctcatccccc acggacgggc caggtcgccc acagtctccg ggtccgagat       780
     ccgccccgaa gccgcgggac cccgagaccc ttgccccggg agaggcccag gcgcctttac       840
     ccggtttcat tttcagttta ggccaaaaat ccccccaggt tggtcggggc ggggcggggc       900
     tcgggggacc gggctgaccg cggggtccgg gccaggttct cacaccgtcc agaggatgta       960
     tggctgcgac gtggggtcgg actggcgctt cctccgcggg taccaccagt acgcctacga      1020
     cggcaaggat tacatcgccc tgaaagagga cctgcgctct tggaccgcgg cggacatggc      1080
     agctcagacc accaagcaca agtgggaggc ggcccatgtg gcggagcagt tgagagccta      1140
     cctggagggc acgtgcgtgg agtggctccg cagatacctg gagaacggga aggagacgct      1200
     gcagcgcacg ggtaccaggg gccacggggc gcctccctga tcgcctgtag atctcccggg      1260
     ctggcctccc acaaggaggg gagacaattg ggaccaacac tagaatatcg ccctccctct      1320
     ggtcctgagg gagaggaatc ctcctgggtt tccagatcct gtaccagaga gtgactctga      1380
     ggttccgccc tgctctctga cacaattaag ggataaaatc tctgaaggaa tgacgggaag      1440
     acgatccctc gaatactgat gagtggttcc ctttgacaca cacaggcagc agccttgggc      1500
     ccgtgacttt tcctctcagg ccttgttctc tgcttcacac tcaatgtgtg tgggggtctg      1560
     agtccagcac ttctgagtcc ttcagcctcc actcaggtca ggaccagaag tcgctgttcc      1620
     ctcttcaggg actagaattt tccacggaat aggagattat cccaggtgcc tgtgtccagg      1680
     ctggtgtctg ggttctgtgc tcccttcccc atcccaggtg tcctgtccat tctcaagata      1740
     gccacatgtg tgctggagga gtgtcccatg acagatgcaa aatgcctgaa tgatctgact      1800
     cttcctgaca gacgccccca aaacgcatat gactcaccac gctgtctctg accatgaagc      1860
     caccctgagg tgctgggccc tgagcttcta ccctgcggag atcacactga cctggcagcg      1920
     ggatggggag gaccagaccc aggacacgga gctcgtggag accaggcctg caggggatgg      1980
     aaccttccag aagtgggcgg ctgtggtggt gccttctgga caggagcaga gatacacctg      2040
     ccatgtgcag catgagggtt tgcccaagcc cctcaccctg agatggggta aggagggaga      2100
     cgggggtgtc atgtctttta gggaaagcag gagcctctct gacctttagc agggtcaggg      2160
     cccctcacct tcccctcttt tcccagagcc gtcttcccag cccaccatcc ccatcgtggg      2220
     catcattgct ggcctggttc tctttggagc tgtgatcact ggagctgtgg tcgctgctgt      2280
     gatgtggagg aggaagagct caggtgggga aggggtgaag ggtgggtctg agatttcttg      2340
     tctcactgag ggttccaaga cccaggtaga agtgtgccct gcctcgttac tgggaagcac      2400
     cacccacaat tatgggccta cccagcctgg gccctgtgtg ccagcactta ctcttttgta      2460
     aagcacctgt taaaatgaag gacagattta tcaccttgat tacagcggtg atgggacctg      2520
     atcccagcag tcacaagtca caggggaagg tccctgagga ccttcaggag ggcggttggt      2580
     ccaggaccca cacctgcttt cttcatgttt cctgatcccg ccctgggtct gcagtcacac      2640
     atttctggaa acttctctga ggtccaagac ttggaggttc ctctaggacc ttaaggccct      2700
     gactcctttc tggtatctca caggacattt tcttcccaca gatagaaaag gagggagcta      2760
     ctctcaggct gcaagtaagt atgaaggagg ctgatgcctg aggtccttgg gatattgtgt      2820
     ttgggagccc atgggggagc tcacccaccc cacaattcct cctctagcca catcttctgt      2880
     gggatctgac caggttctgt ttttgttcta ccccaggcag tgacagtgcc cagggctctg      2940
     atgtgtctct cacagcttgt aaaggtgaga gcctggaggg cctgatgtgt gttgggtgtt      3000
     gggcggaaca gtggacacag ctgtgctatg gggtttcttt ccattggatg tattgagcat      3060
     gcgatgggct gtttaaagtg tgacccctca ctgtgacaga tacgaatttg ttcatgaata      3120
     tttttttcta tagtgtgaga cagctgcctt gtgtgggact gagaggcaag agttgttcct      3180
     gcccttccct ttgtgacttg aagaaccctg actttgtttc tgcaaaggca cctgcatgtg      3240
     tctgtgttcg tgtaggcata atgtgaggag gtggggagac caccccaccc ccatgtccac      3300
     catgaccct                                                              3309
//


spacer
spacer