spacer

EBI Dbfetch

ID   AY973957; SV 1; linear; genomic DNA; STD; HUM; 3255 BP.
XX
AC   AY973957;
XX
DT   25-APR-2005 (Rel. 83, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens truncated MHC class I antigen (HLA-B) gene, HLA-B*1401ne
DE   allele, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3255
RA   Vicario J.L., Alonso-Nieto M.;
RT   "Eight new HLA class I alleles";
RL   Unpublished.
XX
RN   [2]
RP   1-3255
RA   Vicario J.L., Alonso-Nieto M.;
RT   ;
RL   Submitted (25-MAR-2005) to the INSDC.
RL   Histocompatibility, Regional Transfusion Centre, Av. de la Democracia s/n,
RL   Madrid 28032, Spain
XX
DR   MD5; 74dd725f56e8dad2652028bd0b496125.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3255
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <228..>2902
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1401ne"
FT   mRNA            join(<228..300,429..698,945..1220,1793..2068,2162..2278,
FT                   2720..2752,2859..>2902)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1401ne"
FT                   /product="truncated MHC class I antigen"
FT   CDS             join(228..300,429..698,945..1165)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1401ne"
FT                   /product="truncated MHC class I antigen"
FT                   /note="nonfunctional; not found at cell surface of resting
FT                   lymphocytes"
FT                   /db_xref="IMGT/HLA:B*14:07N"
FT                   /protein_id="AAX94766.1"
FT                   /translation="MLVMAPRTVLLLLSAALALTETWAGSHSMRYFYTSVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQICKTNTQTDRESLRN
FT                   LRGYYNQSEAGSHTLQWMYGCDVGPDGRLLRGYNQFAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAAREAEQLRAYLEGT"
FT   exon            <228..300
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1401ne"
FT                   /number=1
FT   exon            429..698
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1401ne"
FT                   /number=2
FT   exon            945..1220
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1401ne"
FT                   /number=3
FT   exon            1793..2068
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1401ne"
FT                   /number=4
FT   exon            2162..2278
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1401ne"
FT                   /number=5
FT   exon            2720..2752
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1401ne"
FT                   /number=6
FT   exon            2859..>2902
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1401ne"
FT                   /number=7
XX
SQ   Sequence 3255 BP; 611 A; 943 C; 1015 G; 686 T; 0 other;
     ccgcgtctgc aatggggagg cgcagcgttg gggattcccc actcccctga gtttcacttc        60
     ttctcccaac ttgtgtcggg tccttcttcc aggatactcg tgacgcatcc ccacttccca       120
     ctcccattgg gtgtcggata tctagagaag ccaatcagcg tcgccggggt cccagttcta       180
     aagtccccac gcacccaccc ggactcagag tctcctcaga cgccaagatg ctggtcatgg       240
     cgccccgaac cgtcctcctg ctgctctcgg cggccctggc cctgaccgag acctgggccg       300
     gtgagtgcgg gtcgggaggg aaatggcctc tgccgggagg agcgagggga ccgcaggcgg       360
     gggcgcagga cctgaggagc cgcgccggga ggagggtcgg gcgggtttca gcccctcctc       420
     gcccccaggc tcccactcca tgaggtattt ctacacctcc gtgtcccggc ccggccgcgg       480
     ggagccccgc ttcatctcag tgggctacgt ggacgacacg cagttcgtga ggttcgacag       540
     cgacgccgcg agtccgagag aggagccgcg ggcgccgtgg atagagcagg aggggccgga       600
     atattgggac cggaacacac agatctgcaa gaccaacaca cagactgacc gagagagcct       660
     gcggaacctg cgcggctact acaaccagag cgaggccggt gagtgacccc ggcccggggc       720
     gcaggtcacg actccccatc ccccacggac ggcccgggtc gccccgagtc tccgggtccg       780
     agatccgcct ccctgaggcc gcgggacccg cccagaccct cgaccggcga gagccccagg       840
     cgcgtttacc cggtttcatt ttcagttgag gccaaaatcc ccgcgggttg gtcggggcgg       900
     ggcggggctc ggggggactg ggctgaccgc gggggcgggg ccagggtctc acaccctcca       960
     gtggatgtat ggctgcgacg tggggccgga cgggcgcctc ctccgcgggt ataaccagtt      1020
     cgcctacgac ggcaaggatt acatcgccct gaacgaggac ctgagctcct ggaccgcggc      1080
     ggacaccgcg gctcagatca cccagcgcaa gtgggaggcg gcccgtgagg cggagcagct      1140
     gagagcctac ctggagggca cgtgagtgga gtggctccgc agacacctgg agaacgggaa      1200
     ggagacgctg cagcgcgcgg gtaccagggg cagtggggag ccttccccat ctcctatagg      1260
     tcgccgggga tggcctccca cgagaagaag aggaaaatgg gatcagcgct agaatgtcgc      1320
     cctcccttga atggagaatg gcatgagttt tcctgagttt cctctgaggg ccccctcttc      1380
     tctctaggac aattaaggga tgacgtctct gaggaaatgg aggggaagac agtccctaga      1440
     atactgatca ggggtcccct ttgacccctg cagcagcctt gggaaccatg acttttcttc      1500
     tcaggccttg ttctctgcct cacactcagt gtgtttgggg ctctgattcc agcacttctg      1560
     agtcacttta cctccactca gatcaggagc agaagtctct gttccccgct cagagactcg      1620
     aactttccaa tgaatagatt atcccaggtg cctgcgtcca ggctggtgtc tgggttctgt      1680
     gtcccttccc caccccaggt gtcctgtcca ttctcaggct ggtcacatgg gtggtcctag      1740
     ggtgtcccat gagagatgca aagcgcctga attttctgac tcttcccatc agacccccca      1800
     aagacacatg tgacccacca ccccatctct gaccatgagg ccaccctgag gtgctgggcc      1860
     ctgggcttct accctgcgga gatcacactg acctggcagc gggatggcga ggaccaaact      1920
     caggacaccg agcttgtgga gaccagacca gcaggagaca gaaccttcca gaagtgggca      1980
     gctgtggtgg tgccttctgg agaagagcag agatacacat gccatgtaca gcatgagggg      2040
     ctgccgaagc ccctcaccct gagatggggt aaggaggggg atgaggggtc atatctcttc      2100
     tcagggaaag caggagccct tcagcagggt cagggcccct catcttcccc tcctttccca      2160
     gagccatctt cccagtccac cgtccccatc gtgggcattg ttgctggcct ggctgtccta      2220
     gcagttgtgg tcatcggagc tgtggtcgct gctgtgatgt gtaggaggaa gagttcaggt      2280
     agggaagggg tgaggggtgg ggtctgggtt ttcttgtccc actgggggtt tcaagcccca      2340
     ggtagaagtg ttccctgcat cattactggg aagcagcatg cacacagggg ctaacgcagc      2400
     ctgggaccct gtgtgccagc acttactctt ttgtgcagca catgtgacaa tgaaggacgg      2460
     atgtatcacc ttgatggttg tggtgttggg gtcctgattc cagcattcat gagtcagggg      2520
     aaggtccctg ctaaggacag accttaggag ggcagttggt ccaggaccca cacttgcttt      2580
     cctcgtgttt cctgatcctg ccctgggtct gtagtcatac ttctggaaat tccttttggg      2640
     tccaagacta ggaggttcct ctaagatctc atggccctgc ttcctcccag tcccctcaca      2700
     ggacattttc ttcccacagg tggaaaagga gggagctact ctcaggctgc gtgtaagtgg      2760
     tgggggtggg agtgtggagg agctcaccca ccccataatt cctcctgtcc cacgtctcct      2820
     gtgggctctg accaggtcct gtttttgttc tactccagcc agcgacagtg cccagggctc      2880
     tgatgtgtct ctcacagctt gaaaaggtga gattcttggg gtctagagtg ggcggggggg      2940
     cggggagggg gcagagggga aaggcctggg taatggagat tctttgattg ggatgtttcg      3000
     cgtgtgtgat gggctgttca gagtgtcatc acttaccatg actaaccaga atttgttcat      3060
     gactgttgtt ttctgtagcc tgagacagct gtcttgtgag ggactgagat gcaggatttc      3120
     ttcacgcctc ccctttgtga cttcaagagc ctctggcatc tctttctgca aaggcacctg      3180
     aatgtgtctg cgtccctgtt agcataatgt gaggaggtgg agagacagcc cacccttgtg      3240
     tccactgtga cccct                                                       3255
//


spacer
spacer