spacer

EBI Dbfetch

ID   AY973955; SV 1; linear; genomic DNA; STD; HUM; 3254 BP.
XX
AC   AY973955;
XX
DT   25-APR-2005 (Rel. 83, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*3906v allele, complete
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3254
RA   Vicario J.L., Alonso-Nieto M.;
RT   "Eight new HLA class I alleles";
RL   Unpublished.
XX
RN   [2]
RP   1-3254
RA   Vicario J.L., Alonso-Nieto M.;
RT   ;
RL   Submitted (25-MAR-2005) to the INSDC.
RL   Histocompatibility, Regional Transfusion Centre, Av. de la Democracia s/n,
RL   Madrid 28032, Spain
XX
DR   MD5; 840ee3b914f83a21f98cde71f89d77d6.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3254
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <228..>2901
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3906v"
FT   mRNA            join(<228..300,429..698,944..1219,1792..2067,2161..2277,
FT                   2719..2751,2858..>2901)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3906v"
FT                   /product="MHC class I antigen"
FT   CDS             join(228..300,429..698,944..1219,1792..2067,2161..2277,
FT                   2719..2751,2858..2901)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3906v"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q52QV7"
FT                   /db_xref="IMGT/HLA:B*39:34"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q52QV7"
FT                   /protein_id="AAX94764.1"
FT                   /translation="MLVMAPRTVLLLLSAALALTETWAGSHSMRYFYTSVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQICKTNTQTDRESLRN
FT                   LRGYYNQSEAGSHTWQTMYGCDVGPDGRLLRGHNQFAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQLRAYLEGTCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGK
FT                   GGSYSQAASSDSAQGSDVSLTA"
FT   exon            <228..300
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3906v"
FT                   /number=1
FT   exon            429..698
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3906v"
FT                   /number=2
FT   exon            944..1219
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3906v"
FT                   /number=3
FT   exon            1792..2067
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3906v"
FT                   /number=4
FT   exon            2161..2277
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3906v"
FT                   /number=5
FT   exon            2719..2751
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3906v"
FT                   /number=6
FT   exon            2858..>2901
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3906v"
FT                   /number=7
XX
SQ   Sequence 3254 BP; 610 A; 945 C; 1015 G; 684 T; 0 other;
     ccgcgtctgc aatggggagg cgcagcgttg gggattcccc actcccctga gtttcacttc        60
     ttctcccaac ttgtgtcggg tccttcttcc aggatactcg tgacgcatcc ccacttccca       120
     ctcccattgg gtgtcggata tctagagaag ccaatcagcg tcgccggggt cccagttcta       180
     aagtccccac gcacccaccc ggactcagag tctcctcaga cgccgagatg ctggtcatgg       240
     cgccccgaac cgtcctcctg ctgctctcgg cggccctggc cctgaccgag acctgggccg       300
     gtgagtgcgg gtcgggaggg aaatggcctc tgccgggagg agcgagggga ccgcaggcgg       360
     gggcgcagga cctgaggagc cgcgccggga ggagggtcgg gcgggtctca gcccctcctc       420
     gcccccaggc tcccactcca tgaggtattt ctacacctcc gtgtcccggc ccggccgcgg       480
     ggagccccgc ttcatctcag tgggctacgt ggacgacacg cagttcgtga ggttcgacag       540
     cgacgccgcg agtccgagag aggagccgcg ggcgccgtgg atagagcagg aggggccgga       600
     atattgggac cggaacacac agatctgcaa gaccaacaca cagactgacc gagagagcct       660
     gcggaacctg cgcggctact acaaccagag cgaggccggt gagtgacccc ggcccggggc       720
     gcaggtcacg actccccatc ccccacgtac ggcccgggtc gccccgagtc tccgggtccg       780
     agatccgcct ccctgaggcc gcgggacccg cccagaccct cgaccggcga gagccccagg       840
     cgcgtttacc cggtttcatt ttcagttgag gccaaaatcc ccgcgggttg gtcggggcgg       900
     ggcggggctc gggggacggg gctgaccgcg gggccggggc cagggtctca cacttggcag       960
     acgatgtatg gctgcgacgt ggggccggac gggcgcctcc tccgcgggca taaccagttc      1020
     gcctacgacg gcaaggatta catcgccctg aacgaggacc tgagctcctg gaccgcggcg      1080
     gacaccgcgg ctcagatcac ccagcgcaag tgggaggcgg cccgtgtggc ggagcagctg      1140
     agagcctacc tggagggcac gtgcgtggag tggctccgca gatacctgga gaacgggaag      1200
     gagacgctgc agcgcgcggg taccaggggc agtggggagc cttccccatc tcctataggt      1260
     cgccggggat ggcctccaac gagaagaaga ggaaaatggg atcagcgcta gaatgtcgcc      1320
     ctcccttgaa tggagaatgg catgagtttt cctgagtttc ctctgagggc cccctcttct      1380
     ctctaggaca attaagggat gacgtctctg aggaaatgga ggggaagaca gtccctagaa      1440
     tactgatcag gggtcccctt tgacccctgc agcagccttg ggaaccatga cttttcctct      1500
     caggccttgt tctctgcctc acactcagtg tgtttggggc tctgattcca gcacttctga      1560
     gtcactttac ctccactcag atcaggagca gaagtctctg ttccccgctc agagactcga      1620
     actttccaat gaatagatta tcccaggtgc ctgcgtccag gctggtgtct gggttctgtg      1680
     ccccttcccc accccaggtg tcctgtccat tctcaggctg gtcacatggg tggtcctagg      1740
     gtgtcccatg agagatgcaa agcgcctgaa ttttctgact cttcccatca gaccccccaa      1800
     agacacatgt gacccaccac cccatctctg accatgaggc caccctgagg tgctgggccc      1860
     tgggcttcta ccctgcggag atcacactga cctggcagcg ggatggcgag gaccaaactc      1920
     aggacaccga gcttgtggag accagaccag caggagacag aaccttccag aagtgggcag      1980
     ctgtggtggt gccttctgga gaagagcaga gatacacatg ccatgtacag catgaggggc      2040
     tgccgaagcc cctcaccctg agatggggta aggaggggga tgaggggtca tatctcttct      2100
     cagggaaagc aggagccctt cagcagggtc agggcccctc atcttcccct cctttcccag      2160
     agccatcttc ccagtccacc gtccccatcg tgggcattgt tgctggcctg gctgtcctag      2220
     cagttgtggt catcggagct gtggtcgctg ctgtgatgtg taggaggaag agttcaggta      2280
     gggaaggggt gaggggtggg gtctgggttt tcttgtccca ctgggggttt caagccccag      2340
     gtagaagtgt tccctgcatc attactggga agcagcatgc acacaggggc taacgcagcc      2400
     tgggaccctg tgtgccagca cttactcttt tgtgcagcac atgtgacaat gaaggacgga      2460
     tgtatcacct tgatggttgt ggtgttgggg tcctgattcc agcattcatg agtcagggga      2520
     aggtccctgc taaggacaga ccttaggagg gcagttggtc caggacccac acttgctttc      2580
     ctcgtgtttc ctgatcctgc cctgggtctg tagtcatact tctggaaatt ccttttgggt      2640
     ccaagactag gaggttcctc taagatctca tggccctgct tcctcccagt cccctcacag      2700
     gacattttct tcccacaggt ggaaaaggag ggagctactc tcaggctgcg tgtaagtggt      2760
     gggggtggga gtgtggagga gctcacccac cccataattc ctcctgtccc acgtctcctg      2820
     tgggctctga ccaggtcctg tttttgttct actccagcca gcgacagtgc ccagggctct      2880
     gatgtgtctc tcacagcttg aaaaggtgag attcttgggg tctagagtgg gcgggggggc      2940
     ggggaggggg cagaggggaa aggcctgggt aatggagatt ctttgattgg gatgtttcgc      3000
     gtgtgtgatg ggctgttcag agtgtcatca cttaccatga ctaaccagaa tttgttcatg      3060
     actgttgttt tctgtagcct gagacagctg tcttgtgagg gactgagatg caggatttct      3120
     tcacgcctcc cctttgtgac ttcaagagcc tctggcatct ctttctgcaa aggcacctga      3180
     atgtgtctgc gtccctgtta gcataatgtg aggaggtgga gagacagccc acccttgtgt      3240
     ccactgtgac ccct                                                        3254
//


spacer
spacer