spacer

EBI Dbfetch

ID   AY971144; SV 1; linear; genomic DNA; STD; HUM; 3266 BP.
XX
AC   AY971144;
XX
DT   25-APR-2005 (Rel. 83, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*07ne allele, complete
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3266
RA   Vicario J.L., Alonso-Nieto M.;
RT   "Eight new HLA class I alleles";
RL   Unpublished.
XX
RN   [2]
RP   1-3266
RA   Vicario J.L., Alonso-Nieto M.;
RT   ;
RL   Submitted (21-MAR-2005) to the INSDC.
RL   Histocompatibility, Regional Transfusion Centre, Av. de la Democracia s/n,
RL   Madrid 28032, Spain
XX
DR   MD5; 9b52773dd0c042b641ea254944e932d1.
DR   EPD; EP73522; HS_HLA-B.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3266
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <228..>2903
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07ne"
FT   mRNA            join(<228..300,429..698,944..1219,1794..2069,2163..2279,
FT                   2721..2753,2860..>2903)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07ne"
FT                   /product="MHC class I antigen"
FT   CDS             join(228..300,429..698,944..1219,1794..2069,2163..2279,
FT                   2721..2753,2860..2903)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07ne"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q52S25"
FT                   /db_xref="IMGT/HLA:B*07:41"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q52S25"
FT                   /protein_id="AAX94763.1"
FT                   /translation="MLVMAPRTVLLLLSAALALTETWAGSHSMRYFYTSVSRPGRGEPR
FT                   FISVRYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRN
FT                   LRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHDQYAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAAREAEQRRAYLEGECVEWLRRYLENGKDKLERADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGK
FT                   GGSYSQAACSDSAQGSDVSLTA"
FT   exon            <228..300
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07ne"
FT                   /number=1
FT   exon            429..698
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07ne"
FT                   /number=2
FT   exon            944..1219
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07ne"
FT                   /number=3
FT   exon            1794..2069
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07ne"
FT                   /number=4
FT   exon            2163..2279
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07ne"
FT                   /number=5
FT   exon            2721..2753
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07ne"
FT                   /number=6
FT   exon            2860..>2903
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07ne"
FT                   /number=7
XX
SQ   Sequence 3266 BP; 603 A; 947 C; 1026 G; 690 T; 0 other;
     ccgcgtctgc aatggggagg cgcagcgttg gggattcccc actcccctga gtttcacttc        60
     ttctcccaac ttgtgtcggg tccttcttcc aggatactcg tgacgcgtcc ccacttccca       120
     ctcccattgg gtattggata tctagagaag ccaatcagcg tcgccgcggt cccagttcta       180
     aagtccccac gcacccaccc ggactcagag tctcctcaga cgccgagatg ctggtcatgg       240
     cgccccgaac cgtcctcctg ctgctctcgg cggccctggc cctgaccgag acctgggccg       300
     gtgagtgcgg gtcgggaggg aaatggcctc tgccgggagg agcgagggga ccgcaggcgg       360
     gggcgcagga cctgaggagc cgcgccggga ggagggtcgg gcgggtctca gcccctcctc       420
     acccccaggc tcccactcca tgaggtattt ctacacctcc gtgtcccggc ccggccgcgg       480
     ggagccccgc ttcatctcag tgcgctacgt ggacgacacc cagttcgtga ggttcgacag       540
     cgacgccgcg agtccgagag aggagccgcg ggcgccgtgg atagagcagg aggggccgga       600
     gtattgggac cggaacacac agatctacaa ggcccaggca cagactgacc gagagagcct       660
     gcggaacctg cgcggctact acaaccagag cgaggccggt gagtgacccc ggcccggggc       720
     gcaggtcacg actccccatc ccccacgtac ggcccgggtc gccccgagtc tccgggtccg       780
     agatccgcct ccctgaggcc gcgggacccg cccagaccct cgaccggcga gagccccagg       840
     cgcgtttacc cggtttcatt ttcagttgag gccaaaatcc ccgcgggttg gtcggggcgg       900
     ggcggggctc gggggactgg gctgaccgcg gggccggggc cagggtctca caccctccag       960
     agcatgtacg gctgcgacgt ggggccggac gggcgcctcc tccgcgggca tgaccagtac      1020
     gcctacgacg gcaaggatta catcgccctg aacgaggacc tgcgctcctg gaccgccgcg      1080
     gacacggcgg ctcagatcac ccagcgcaag tgggaggcgg cccgtgaggc ggagcagcgg      1140
     agagcctacc tggagggcga gtgcgtggag tggctccgca gatacctgga gaacgggaag      1200
     gacaagctgg agcgcgctgg taccaggggc agtggggagc cttccccatc tcctataggt      1260
     cgccggggat ggcctcccac gagaagagga ggaaaatggg atcagcgcta gaatgtcgcc      1320
     ctccgttgaa tggagaatgg catgagtttt cctgagtttc ctctgagggc cccctcttct      1380
     ctctagacaa ttaaggaatg acgtctctga ggaaatggag gggaagacag tccctagaat      1440
     actgatcagg ggtccccttt gacccctgca gcagccttgg gaaccgtgac ttttcctctc      1500
     aggccttgtt ctctgcctca cactcagtgt gtttggggct ctgattccag cacttctgag      1560
     tcactttacc tccactcaga tcaggagcag aagtccctgt tccccgctca gagactcgaa      1620
     ctttccaatg aataggagat tatcccaggt gcctgcgtcc aggctggtgt ctgggttctg      1680
     tgccccttcc ccaccccagg tgtcctgtcc attctcaggc tggtcacatg ggtggtccta      1740
     gggtgtccca tgaaagatgc aaagcgcctg aattttctga ctcttcccat cagacccccc      1800
     aaagacacac gtgacccacc accccatctc tgaccatgag gccaccctga ggtgctgggc      1860
     cctgggtttc taccctgcgg agatcacact gacctggcag cgggatggcg aggaccaaac      1920
     tcaggacact gagcttgtgg agaccagacc agcaggagat agaaccttcc agaagtgggc      1980
     agctgtggtg gtgccttctg gagaagagca gagatacaca tgccatgtac agcatgaggg      2040
     gctgccgaag cccctcaccc tgagatgggg taaggagggg gatgaggggt catatctctt      2100
     ctcagggaaa gcaggagccc ttcagcaggg tcagggcccc tcatcttccc ctcctttccc      2160
     agagccgtct tcccagtcca ccgtccccat cgtgggcatt gttgctggcc tggctgtcct      2220
     agcagttgtg gtcatcggag ctgtggtcgc tgctgtgatg tgtaggagga agagttcagg      2280
     tagggaaggg gtgaggggtg gggtctgggt tttcttgtcc cactgggggt ttcaagcccc      2340
     aggtagaagt gttccctgcc tcattactgg gaagcagcat gcacacaggg gctaacgcag      2400
     cctgggaccc tgtgtgccag cacttactct tttgtgcagc acatgtgaca atgaaggatg      2460
     gatgtatcac cttgatggtt gtggtgttgg ggtcctgatt ccagcattca tgagtcaggg      2520
     gaaggtccct gctaaggaca gaccttagga gggcagttgg tccaggaccc acacttgctt      2580
     tcctcgtgtt tcctgatcct gccctgggtc tgtagtcata cttctggaaa ttccttttgg      2640
     gtccaagact aggaggttcc tctaagatct catggccctg cttcctccca gtgccctcac      2700
     aggacatttt cttcccacag gtggaaaagg agggagctac tctcaggctg cgtgtaagtg      2760
     gtgggggtgg gagtgtggag gagctcaccc accccataat tcctcctgtc ccacgtctcc      2820
     tgcgggctct gaccaggtcc tgtttttgtt ctactccagg cagcgacagt gcccagggct      2880
     ctgatgtgtc tctcacagct tgaaaaggtg agattcttgg ggtctagagt gggtggggtg      2940
     gcgggtctgg gggtgggtgg ggcagagggg aaaggcctgg gtaatgggga ttctttgatt      3000
     gggatgtttc gcgtgtgtgg tgggctgttt agagtgtcat cgcttaccat gactaaccag      3060
     aatttgttca tgactgttgt tttctgtagc ctgagacagc tgtcttgtga gggactgaga      3120
     tgcaggattt cttcacgcct cccctttgtg acttcaagag cctctggcat ctctttctgc      3180
     aaaggcacct gaatgtgtct gcgtccctgt tagcataatg tgaggaggtg gagagacagc      3240
     ccacccttgt gtccactgtg acccct                                           3266
//


spacer
spacer