spacer

EBI Dbfetch

ID   AH014809; SV 2; linear; genomic DNA; STD; HUM; 1023 BP.
XX
AC   AH014809; AY963804-AY963806;
XX
DT   31-JUL-2011 (Rel. 109, Created)
DT   31-JUL-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens truncated MHC class I antigen (HLA-A*26) gene, HLA-A*26 null
DE   variant allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1023
RA   Sandschulte C.C., Hiraki D.D., Grumet F.C.;
RT   "Identification of a Novel A*26 Null Allele";
RL   Unpublished.
XX
RN   [2]
RP   1-1023
RA   Sandschulte C.C., Hiraki D.D., Grumet F.C.;
RT   ;
RL   Submitted (16-MAR-2005) to the INSDC.
RL   Stanford Blood Center, 800 Welch Rd., Palo Alto, CA 94304, USA
XX
CC   On or before Jul 29, 2011 this sequence version replaced
CC   gi:62183537, gi:62183538, gi:62183539, gi:62183536.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1023
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1023
FT                   /gene="HLA-A*26"
FT                   /allele="HLA-A*26 null variant"
FT                   /note="nonfunctional MHC class I antigen due to frameshift
FT                   in exon 2"
FT   mRNA            join(<1..271,372..647,748..>1023)
FT                   /gene="HLA-A*26"
FT                   /allele="HLA-A*26 null variant"
FT                   /product="truncated MHC class I antigen"
FT   exon            <1..271
FT                   /gene="HLA-A*26"
FT                   /allele="HLA-A*26 null variant"
FT                   /number=2
FT                   /note="contains frameshift"
FT   CDS             <1..221
FT                   /codon_start=3
FT                   /gene="HLA-A*26"
FT                   /allele="HLA-A*26 null variant"
FT                   /product="truncated MHC class I antigen"
FT                   /protein_id="AAX73212.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDRNTRNVKAPLTD"
FT   gap             272..371
FT                   /estimated_length=unknown
FT   exon            372..647
FT                   /gene="HLA-A*26"
FT                   /allele="HLA-A*26 null variant"
FT                   /number=3
FT   gap             648..747
FT                   /estimated_length=unknown
FT   exon            748..>1023
FT                   /gene="HLA-A*26"
FT                   /allele="HLA-A*26 null variant"
FT                   /number=4
XX
SQ   Sequence 1023 BP; 167 A; 250 C; 287 G; 119 T; 200 other;
     gctcccactc catgaggtat ttctacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acggaatgtg aaggccccac tcacagactg accgagcgaa cctggggacc       240
     ctgcgcggct actacaacca gagcgaggac gnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ngttctcaca ccatccagag gatgtatggc tgcgacgtgg ggccggacgg       420
     gcgcttcctc cgcgggtacc agcaggacgc ttacgacggc aaggattaca tcgccctgaa       480
     cgaggacctg cgctcttgga ccgcggcgga catggcggct cagatcaccc agcgcaagtg       540
     ggagacggcc catgaggcgg agcagtggag agcctacctg gagggccggt gcgtggagtg       600
     gctccgcaga tacctggaga acgggaagga gacgctgcag cgcacggnnn nnnnnnnnnn       660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       720
     nnnnnnnnnn nnnnnnnnnn nnnnnnnacg cccccaagac gcatatgact caccacgctg       780
     tctctgacca tgaggccacc ctgaggtgct gggccctgag cttctaccct gcggagatca       840
     cactgacctg gcagcgggat ggggaggacc agacccagga cacggagctc gtggagacca       900
     ggcctgcagg ggatgggacc ttccagaagt gggcgtctgt ggtggtgcct tctggacagg       960
     agcagagata cacctgccat gtgcagcatg agggtctgcc caagcccctc accctgagat      1020
     ggg                                                                    1023
//


spacer
spacer