spacer

EBI Dbfetch

ID   AY961619; SV 1; linear; genomic DNA; STD; HUM; 1107 BP.
XX
AC   AY961619;
XX
DT   06-APR-2005 (Rel. 83, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*40N1 allele, exons 1
DE   through 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1107
RX   DOI; 10.1111/j.1399-0039.2006.00568.x.
RX   PUBMED; 16634873.
RA   Shan X., Gao G., He X., Wu G., Zhang Z.;
RT   "Identification of a novel HLA-B allele HLA-B*4059 in Chinese bone marrow
RT   donors";
RL   Tissue Antigens 67(4):339-340(2006).
XX
RN   [2]
RP   1-1107
RA   Shan X., Wang L., Gao G., He X., Li W., Zhang Z.;
RT   "Description of a new HLA-B B*40N1";
RL   Unpublished.
XX
RN   [3]
RP   1-1107
RA   Shan X., Wang L., Gao G., He X., Li W., Zhang Z.;
RT   ;
RL   Submitted (11-MAR-2005) to the INSDC.
RL   Bone Marrow Donor Bank HLA Lab, Beijing Red Cross Blood Center, East
RL   Sanhuan Middle Street, Beijing, Beijing 100088, China
XX
DR   MD5; 2fed16bb13ea3b3dc2313cbbed717202.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1107
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <60..>1051
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40N1"
FT   mRNA            join(<60..132,261..530,776..>1051)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40N1"
FT                   /product="MHC class I antigen"
FT   CDS             join(60..132,261..530,776..>1051)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40N1"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q56FB2"
FT                   /db_xref="IMGT/HLA:B*40:59"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q56FB2"
FT                   /protein_id="AAX63417.1"
FT                   /translation="MRVTAPRTVLLLLSAALALTETWAGSHSMRYFHTAMSRPGRGEPR
FT                   FITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRESLRN
FT                   LRGYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQSAYDGKDYIALNEDLRSWTAADTA
FT                   AQISQRKLEAARVAEQLRAYLEGECVEWLRRYLENGKDKLERA"
FT   exon            <60..132
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40N1"
FT                   /number=1
FT   exon            261..530
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40N1"
FT                   /number=2
FT   exon            776..1051
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40N1"
FT                   /number=3
XX
SQ   Sequence 1107 BP; 190 A; 372 C; 395 G; 150 T; 0 other;
     gtcccagttc taaagtcccc acgcacccac ccggactcag aatctcctca gacgccgaga        60
     tgcgggtcac ggcaccccga accgtcctcc tgctgctctc ggcggccctg gccctgaccg       120
     agacctgggc cggtgagtgc gggtcggcag ggaaatggcc tctgtgggga ggagcgaggg       180
     gaccgcaggc gggggcgcag gacccgggga gccgcgccgg gaggagggtc gggcgggtct       240
     cagctcctcc tcgcccccag gctcccactc catgaggtat ttccacaccg ccatgtcccg       300
     gcccggccgc ggggagcccc gcttcatcac cgtgggctac gtggacgaca cgctgttcgt       360
     gaggttcgac agcgacgcca cgagtccgag gaaggagccg cgggcgccat ggatagagca       420
     ggaggggccg gagtattggg accgggagac acagatctcc aagaccaaca cacagactta       480
     ccgagagagc ctgcggaacc tgcgcggcta ctacaaccag agcgaggccg gtgagtgacc       540
     ccggcccggg gcgcaggtca cgactcccca tcccccacgt acggcccggg tcgccccgag       600
     tctccgggtc cgagatccga ccccctgagg ccgcgggacc cgcccagacc ctcgaccggc       660
     gagagcccca ggcgcgttta cccggtttca ttttcagttg aggccaaaat ccccgcgggt       720
     tggtcggggc ggggcggggc tcgggggact gggctgaccg cggggccggg gccagggtct       780
     cacatcatcc agaggatgta tggctgcgac ctggggcccg acgggcgcct cctccgcggg       840
     catgaccagt ccgcctacga cggcaaggat tacatcgccc tgaacgagga cctgcgctcc       900
     tggaccgccg cggacacggc ggctcagatc tcccagcgca agttggaggc ggcccgtgtg       960
     gcggagcagc tgagagccta cctggagggc gagtgcgtgg agtggctccg cagatacctg      1020
     gagaacggga aggacaagct ggagcgcgct ggtaccaggg gcagtgggga gccttcccca      1080
     tctcctatag gtcgccgggg atggcct                                          1107
//


spacer
spacer