spacer

EBI Dbfetch

ID   AY961078; SV 1; linear; mRNA; STD; HUM; 801 BP.
XX
AC   AY961078;
XX
DT   06-APR-2005 (Rel. 83, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) mRNA, HLA-DRB1*0818 allele,
DE   complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-801
RX   DOI; 10.1016/j.humimm.2006.09.002.
RX   PUBMED; 17174751.
RA   Balas A., Vilches C., Rodriguez M.A., Fernandez B., Martinez M.P.,
RA   de Pablo R., Garcia-Sanchez F., Vicario J.L.;
RT   "Group-specific amplification of cDNA from DRB1 genes. Complete coding
RT   sequences of partially defined alleles and identification of the new
RT   alleles DRB1*040602, DRB1*111102, DRB1*080103, and DRB1*0113";
RL   Hum. Immunol. 67(12):1008-1016(2006).
XX
RN   [2]
RP   1-801
RA   Balas A., Garcia-Sanchez F., Vicario J.L.;
RT   ;
RL   Submitted (14-MAR-2005) to the INSDC.
RL   Histocompatibility, CTM, Avenida De La Democracia, Madrid 28032, Spain
XX
DR   MD5; a22568cc0bc58456b0f0b2ec40cdec89.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..801
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   gene            1..801
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*0818"
FT   CDS             1..801
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*0818"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q56FN4"
FT                   /db_xref="H-InvDB:HIT000333388_03.4"
FT                   /db_xref="IMGT/HLA:DRB1*08:18"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q56FN4"
FT                   /protein_id="AAX63466.1"
FT                   /translation="MVCLRLPGGSCMAVLTVTLMVLSSPLALAGDTRPRFLEYSTGECY
FT                   FFNGTERVRFLDRYFYNQEEYVRFDSDVGEYRAVTELGRPSAEYWNSQKDILEDRRAAV
FT                   DTYCRHNYGVGESFTVQRRVHPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRN
FT                   GQEEKTGVVSTGLIHNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWSARSE
FT                   SAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS"
XX
SQ   Sequence 801 BP; 172 A; 202 C; 258 G; 169 T; 0 other;
     atggtgtgtc tgaggctccc tggaggctcc tgcatggcag ttctgacagt gacactgatg        60
     gtgctgagct ccccactggc tttggctggg gacaccagac cacgtttctt ggagtactct       120
     acgggtgagt gttatttctt caatgggacg gagcgggtgc ggttcctgga cagatacttc       180
     tataaccaag aggagtacgt gcgcttcgac agcgacgtgg gggagtaccg ggcggtgacg       240
     gagctggggc ggcctagcgc cgagtactgg aacagccaga aggacatcct ggaagacagg       300
     cgggccgcgg tggacaccta ctgcagacac aactacgggg ttggtgagag cttcacagtg       360
     cagcggcgag tccatcctaa ggtgactgtg tatccttcaa agacccagcc cctgcagcac       420
     cacaacctcc tggtctgttc tgtgagtggt ttctatccag gcagcattga agtcaggtgg       480
     ttccggaatg gccaggaaga gaagactggg gtggtgtcca caggcctgat ccacaatgga       540
     gactggacct tccagaccct ggtgatgctg gaaacagttc ctcggagtgg agaggtttac       600
     acctgccaag tggagcaccc aagcgtgaca agccctctca cagtggaatg gagtgcacgg       660
     tctgaatctg cacagagcaa gatgctgagt ggagtcgggg gctttgtgct gggcctgctc       720
     ttccttgggg ccgggctgtt catctacttc aggaatcaga aaggacactc tggactccag       780
     ccaacaggat tcctgagctg a                                                 801
//


spacer
spacer