spacer

EBI Dbfetch

ID   AY961062; SV 1; linear; mRNA; STD; HUM; 801 BP.
XX
AC   AY961062;
XX
DT   06-APR-2005 (Rel. 83, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) mRNA, HLA-DRB1*0410 allele,
DE   complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-801
RX   DOI; 10.1016/j.humimm.2006.09.002.
RX   PUBMED; 17174751.
RA   Balas A., Vilches C., Rodriguez M.A., Fernandez B., Martinez M.P.,
RA   de Pablo R., Garcia-Sanchez F., Vicario J.L.;
RT   "Group-specific amplification of cDNA from DRB1 genes. Complete coding
RT   sequences of partially defined alleles and identification of the new
RT   alleles DRB1*040602, DRB1*111102, DRB1*080103, and DRB1*0113";
RL   Hum. Immunol. 67(12):1008-1016(2006).
XX
RN   [2]
RP   1-801
RA   Balas A., Garcia-Sanchez F., Vicario J.L.;
RT   ;
RL   Submitted (14-MAR-2005) to the INSDC.
RL   Histocompatibility, CTM, Avenida De La Democracia, Madrid 28032, Spain
XX
DR   MD5; 818a7a4c6843def212e9be723113f0cb.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..801
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   gene            1..801
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*0410"
FT   CDS             1..801
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*0410"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q8TB62"
FT                   /db_xref="H-InvDB:HIT000333372_03.4"
FT                   /db_xref="IMGT/HLA:DRB1*04:10:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q8TB62"
FT                   /protein_id="AAX63450.1"
FT                   /translation="MVCLKFPGGSCMAALTVTLMVLSSPLALAGDTRPRFLEQVKHECH
FT                   FFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAVTELGRPSAEYWNSQKDLLEQRRAAV
FT                   DTYCRHNYGVVESFTVQRRVYPEVTVYPAKTQPLQHHNLLVCSVNGFYPGSIEVRWFRN
FT                   GQEEKTGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSLTSPLTVEWRARSE
FT                   SAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS"
XX
SQ   Sequence 801 BP; 172 A; 207 C; 259 G; 163 T; 0 other;
     atggtgtgtc tgaagttccc tggaggctcc tgcatggcag ctctgacagt gacactgatg        60
     gtgctgagct ccccactggc tttggctggg gacacccgac cacgtttctt ggagcaggtt       120
     aaacatgagt gtcatttctt caacgggacg gagcgggtgc ggttcctgga cagatacttc       180
     tatcaccaag aggagtacgt gcgcttcgac agcgacgtgg gggagtaccg ggcggtgacg       240
     gagctggggc ggcctagcgc cgagtactgg aacagccaga aggacctcct ggagcagagg       300
     cgggccgcgg tggacaccta ctgcagacac aactacgggg ttgtggagag cttcacagtg       360
     cagcggcgag tctatcctga ggtgactgtg tatcctgcaa agacccagcc cctgcagcac       420
     cacaacctcc tggtctgctc tgtgaatggt ttctatccag gcagcattga agtcaggtgg       480
     ttccggaacg gccaggaaga gaagactggg gtggtgtcca caggcctgat ccagaatgga       540
     gactggacct tccagaccct ggtgatgctg gaaacagttc ctcggagtgg agaggtttac       600
     acctgccaag tggagcaccc aagcctgacg agccctctca cagtggaatg gagagcacgg       660
     tctgaatctg cacagagcaa gatgctgagt ggagtcgggg gcttcgtgct gggcctgctc       720
     ttccttgggg ccgggctgtt catctacttc aggaatcaga aaggacactc tggacttcag       780
     ccaacaggat tcctgagctg a                                                 801
//


spacer
spacer