Dbfetch

ID   AY958608; SV 1; linear; genomic DNA; STD; HUM; 269 BP.
XX
AC   AY958608;
XX
DT   10-MAY-2005 (Rel. 83, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB3) gene, HLA-DRB3*02 allele, exon
DE   2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-269
RA   Colombini I., Malagoli A., Carella G.;
RT   "New HLA-DRB3*02 allele";
RL   Unpublished.
XX
RN   [2]
RP   1-269
RA   Colombini I., Malagoli A., Carella G.;
RT   ;
RL   Submitted (05-MAR-2005) to the INSDC.
RL   Spedali Civili Brescia, Histocompatibility Laboratory, Piazza Spedali
RL   Civili N.1, Brescia, BS 25123, Italia
XX
DR   MD5; 79a99e5fad4887a246c74005f12524d2.
DR   Ensembl-Gn; ENSG00000196101; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231679; homo_sapiens.
DR   Ensembl-Tr; ENST00000307137; homo_sapiens.
DR   Ensembl-Tr; ENST00000383126; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..269
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>269
FT                   /gene="HLA-DRB3"
FT                   /allele="HLA-DRB3*02"
FT   mRNA            <1..>269
FT                   /gene="HLA-DRB3"
FT                   /allele="HLA-DRB3*02"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>269
FT                   /codon_start=3
FT                   /gene="HLA-DRB3"
FT                   /allele="HLA-DRB3*02"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:P79483"
FT                   /db_xref="HGNC:HGNC:4951"
FT                   /db_xref="IMGT/HLA:DRB3*02:20"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:2Q6W"
FT                   /db_xref="PDB:3C5J"
FT                   /db_xref="PDB:4H1L"
FT                   /db_xref="UniProtKB/Swiss-Prot:P79483"
FT                   /protein_id="AAY28717.1"
FT                   /translation="RFLELLKSECHFFNGTERVRFLERHFHNQEENVRFDSDVGEYRAV
FT                   RELGRPDAEYWNSQKDLLEQKRGQVDNYCRHNYGVGESFTVQRR"
FT   exon            <1..>269
FT                   /gene="HLA-DRB3"
FT                   /allele="HLA-DRB3*02"
FT                   /number=2
XX
SQ   Sequence 269 BP; 60 A; 61 C; 99 G; 49 T; 0 other;
     cacgtttctt ggagctgctt aagtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga gagacacttc cataaccagg aggagaacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgagg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacctcct ggagcagaag cggggccagg tggacaatta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcga                                         269
//