spacer

EBI Dbfetch

ID   AY957461; SV 1; linear; genomic DNA; STD; HUM; 1894 BP.
XX
AC   AY957461;
XX
DT   04-APR-2005 (Rel. 83, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*3709 allele, exons 1
DE   through 4 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1894
RA   Avergas C.U., Scott J.K., Eller S.R., Iglehart B.S., Leffell M.S.;
RT   "Identification of a Novel Allele: B*3709";
RL   Unpublished.
XX
RN   [2]
RP   1-1894
RA   Avergas C.U., Scott J.K., Eller S.R., Iglehart B.S., Leffell M.S.;
RT   ;
RL   Submitted (09-MAR-2005) to the INSDC.
RL   Medicine, Johns Hopkins University, 2041 E. Monument St, Baltimore, MD
RL   21205, USA
XX
DR   MD5; ef5f4cbe1e7ce717de40d718530a75c4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1894
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1801
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3709"
FT   mRNA            join(<1..32,162..431,678..953,1526..>1801)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3709"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..32,162..431,678..953,1526..>1801)
FT                   /codon_start=2
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3709"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q56H29"
FT                   /db_xref="IMGT/HLA:B*37:09"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q56H29"
FT                   /protein_id="AAX56911.1"
FT                   /translation="GAVALTETWAGSHSMRYFHTSVSRPGRGEPRFISVGYVDDTQFVR
FT                   FDSDAASPRTEPRAPWIEQEGPEYWDRETQISKTNTQTYREDLRTLLRYYNQSEAGSHT
FT                   LQSMYGCDVGPDGRLLRGHDQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVA
FT                   EQDRAYLEGTCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAE
FT                   ITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLT
FT                   LRW"
FT   exon            <1..32
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3709"
FT                   /number=1
FT   exon            162..431
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3709"
FT                   /number=2
FT   exon            678..953
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3709"
FT                   /number=3
FT   exon            1526..1801
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3709"
FT                   /number=4
XX
SQ   Sequence 1894 BP; 360 A; 591 C; 619 G; 324 T; 0 other;
     gggggcagtg gccctgaccg agacctgggc tggtgagtgc ggggtcggca gggaaatggc        60
     ctctgtgggg aggagcgagg ggaccgcagg cgggggcgca ggacccgggg agccgcgccg       120
     ggaggagggt cgggcgggtc tcagcccctc ctcgccccca ggctcccact ccatgaggta       180
     tttccacacc tccgtgtccc ggcccggccg cggggagccc cgcttcatct cagtgggcta       240
     cgtggacgac acccagttcg tgaggttcga cagcgacgcc gcgagtccga ggacggagcc       300
     ccgggcgccg tggatagagc aggaggggcc ggagtattgg gaccgggaga cacagatctc       360
     caagaccaac acacagactt accgagagga cctgcggacc ctgctccgct actacaacca       420
     gagcgaggcc ggtgagtgac cccggcccgg ggcgcaggtc acgactcccc atcccccacg       480
     tacggcccgg gtcgccccga gtctccgggt ccgagatccg cccccctgag gccgcgggac       540
     ccgcccagac cctcgaccgg cgagagcccc aggcgcgttt acccggtttc attttcagtt       600
     gaggccaaaa tccccgcggg ttggtcgggg cggggcgggg ctcgggggga cggggctgac       660
     cgcggggccg gggccagggt ctcacaccct ccagagcatg tacggctgcg acgtggggcc       720
     ggacgggcgc ctcctccgcg ggcatgacca gtacgcctac gacggcaagg attacatcgc       780
     cctgaacgag gacctgcgct cctggaccgc cgcggacacc gcggctcaga tcacccagcg       840
     caagtgggag gcggcccgtg tggcggagca ggacagagcc tacctggagg gcacgtgcgt       900
     ggagtggctc cgcagatacc tggagaacgg gaaggagacg ctgcagcgcg cgggtaccag       960
     gggcagtggg gagccttccc catctcctat aggtcgccgg ggatggcctc ccacgagaag      1020
     aggaggaaaa tgggatcagc gctagaatgt cgccctccct tgaatggaga atggcatgag      1080
     ttttcctgag tttcctctga gggccccctc ttctctctag gacaattaag ggatgacgtc      1140
     tctgaggaaa tggaggggaa gacagtccct agaatactga tcaggggtcc cctttgaccc      1200
     ctgcagcagc cttgggaacc atgacttttc ctctcaggcc ttgttctctg cctcacactc      1260
     agtgtgtttg gggctctgat tccagcactt ctgagtcact ttacctccac tcagatcagg      1320
     agcagaagtc tctgttcccc gctcagagac tcgaactttc caatgaatag attatcccag      1380
     gtgcctgcgt ccaggctggt gtctgggttc tgtgcccctt ccccacccca ggtgtcctgt      1440
     ccattctcag gctggtcaca tgggtggtcc tagggtgtcc catgagagat gcaaagcgcc      1500
     tgaattttct gactcttccc atcagacccc ccaaagacac atgtgaccca ccaccccatc      1560
     tctgaccatg aggccaccct gaggtgctgg gccctgggct tctaccctgc ggagatcaca      1620
     ctgacctggc agcgggatgg cgaggaccaa actcaggaca ccgagcttgt ggagaccaga      1680
     ccagcaggag atagaacctt ccagaagtgg gcagctgtgg tggtgccttc tggagaagag      1740
     cagagataca catgccatgt acagcatgag gggctgccga agcccctcac cctgagatgg      1800
     ggtaaggagg gggatgaggg gtcatatctc ttctcaggga aagcaggagc ccttctggag      1860
     cccttcagca gggtcaggac ccctcatctt cccc                                  1894
//


spacer
spacer