spacer

EBI Dbfetch

ID   AY957460; SV 1; linear; genomic DNA; STD; HUM; 1925 BP.
XX
AC   AY957460;
XX
DT   04-APR-2005 (Rel. 83, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*140202 allele, exons 1
DE   through 5 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1925
RA   Scott J.K., Avergas C.U., Eller S.R., Iglehart B.S., Leffell M.S.;
RT   "Identification of a Novel Allele: B*140202";
RL   Unpublished.
XX
RN   [2]
RP   1-1925
RA   Scott J.K., Avergas C.U., Eller S.R., Iglehart B.S., Leffell M.S.;
RT   ;
RL   Submitted (09-MAR-2005) to the INSDC.
RL   Medicine, Johns Hopkins University, 2041 E. Monument St, Baltimore, MD
RL   21205, USA
XX
DR   MD5; 9ef1a9b4b2b267ce235cb67bee5683df.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1925
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1925
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*140202"
FT   mRNA            join(<1..28,157..426,673..948,1521..1796,1890..>1925)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*140202"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..28,157..426,673..948,1521..1796,1890..>1925)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*140202"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q56H30"
FT                   /db_xref="IMGT/HLA:B*14:02:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="PDB:3BVN"
FT                   /db_xref="PDB:3BXN"
FT                   /db_xref="UniProtKB/TrEMBL:Q56H30"
FT                   /protein_id="AAX56910.1"
FT                   /translation="ALALTETWAGSHSMRYFYTAVSRPGRGEPRFISVGYVDDTQFVRF
FT                   DSDAASPREEPRAPWIEQEGPEYWDRNTQICKTNTQTDRESLRNLRGYYNQSEAGSHTL
FT                   QWMYGCDVGPDGRLLRGYNQFAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAE
FT                   QLRAYLEGTCVEWLRRHLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEI
FT                   TLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTL
FT                   RWEPSSQSTVPIVG"
FT   exon            <1..28
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*140202"
FT                   /number=1
FT   exon            157..426
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*140202"
FT                   /number=2
FT   exon            673..948
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*140202"
FT                   /number=3
FT   exon            1521..1796
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*140202"
FT                   /number=4
FT   exon            1890..>1925
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*140202"
FT                   /number=5
XX
SQ   Sequence 1925 BP; 370 A; 598 C; 623 G; 334 T; 0 other;
     gccctggccc tgaccgagac ctgggccggt gagtgcgggt cgggagggaa atggcctctg        60
     ccgggaggag cgaggggacc gcaggcgggg gcgcaggacc tgaggagccg cgccgggagg       120
     agggtcgggc gggtttcagc ccctcctcgc ccccaggctc ccactccatg aggtatttct       180
     acaccgccgt gtcccggccc ggccgcgggg agccccgctt catctcagtg ggctacgtgg       240
     acgacacgca gttcgtgagg ttcgacagcg acgccgcgag tccgagagag gagccgcggg       300
     cgccgtggat agagcaggag gggccggaat attgggaccg gaacacacag atctgcaaga       360
     ccaacacaca gactgaccga gagagcctgc ggaacctgcg cggctactac aaccagagcg       420
     aggccggtga gtgaccccgg cccggggcgc aggtcacgac tccccatccc ccacggacgg       480
     cccgggtcgc cccgagtctc cgggtccgag atccgcctcc ctgaggccgc gggacccgcc       540
     cagaccctcg accggcgaga gccccaggcg cgtttacccg gtttcatttt cagttgaggc       600
     caaaatcccc gcgggttggg cggggcgggg cggggctcgg ggggactggg ctgaccgcgg       660
     gggcggggcc agggtctcac accctccagt ggatgtatgg ctgcgacgtg gggccggacg       720
     ggcgcctcct ccgcgggtat aaccagttcg cctacgacgg caaggattac atcgccctga       780
     acgaggacct gagctcctgg accgcggccg acaccgcggc tcagatcacc cagcgcaagt       840
     gggaggcggc ccgtgaggcg gagcagctga gagcctacct ggagggcacg tgcgtggagt       900
     ggctccgcag acacctggag aacgggaagg agacgctgca gcgcgcgggt accaggggca       960
     gtggggagcc ttccccatct cctataggtc gccggggatg gcctcccacg agaagaagag      1020
     gaaaatggga tcagcgctag aatgtcgccc tcccttgaat ggagaatggc atgagttttc      1080
     ctgagtttcc tctgagggcc ccctcttctc tctaggacaa ttaagggatg acgtctctga      1140
     ggaaatggag gggaagacag tccctagaat actgatcagg ggtccccttt gacccctgca      1200
     gcagccttgg gaaccatgac ttttcttctc aggccttgtt ctctgcctca cactcagtgt      1260
     gtttggggct ctgattccag cacttctgag tcactttacc tccactcaga tcaggagcag      1320
     aagtctctgt tccccgctca gagactcgaa ctttccaatg aatagattat cccaggtgcc      1380
     tgcgtccagg ctggtgtctg ggttctgtgt cccttcccca ccccaggtgt cctgtccatt      1440
     ctcaggctgg tcacatgggt ggtcctaggg tgtcccatga gagatgcaaa gcgcctgaat      1500
     tttctgactc ttcccatcag accccccaaa gacacatgtg acccaccacc ccatctctga      1560
     ccatgaggcc accctgaggt gctgggccct gggcttctac cctgcggaga tcacactgac      1620
     ctggcagcgg gatggcgagg accaaactca ggacaccgag cttgtggaga ccagaccagc      1680
     aggagacaga accttccaga agtgggcagc tgtggtggtg ccttctggag aagagcagag      1740
     atacacatgc catgtacagc atgaggggct gccgaagccc ctcaccctga gatggggtaa      1800
     ggagggggat gaggggtcat atctcttctc agggaaagca ggagcccttc agcagggtca      1860
     gggcccctca tcttcccctc ctttcccaga gccatcttcc cagtccaccg tccccatcgt      1920
     gggca                                                                  1925
//


spacer
spacer