spacer

EBI Dbfetch

ID   AY947482; SV 2; linear; mRNA; STD; HUM; 868 BP.
XX
AC   AY947482;
XX
DT   26-MAR-2005 (Rel. 83, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Homo sapiens GRB2010154 truncated MHC class II antigen (HLA-DOA) mRNA,
DE   complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-868
RX   DOI; 10.1111/j.1399-0039.2005.00446.x.
RX   PUBMED; 16101837.
RA   Moon S.M., Gu H., Ryu H.J., Kim J.J., Kim H.T., Han B.G., Kimm K.,
RA   Lee J.K., Oh B.;
RT   "Identification of four novel HLA-DOA alleles, DOA*010106, DOA*0102,
RT   DOA*0103, and DOA*0104N, by sequence-based typing*";
RL   Tissue Antigens 66(3):242-245(2005).
XX
RN   [2]
RP   1-868
RA   Moon S.-M., Gu H., Lee J.-K., Oh B.;
RT   ;
RL   Submitted (27-FEB-2005) to the INSDC.
RL   Functional and Structural Genomics, National Genome Research Institute, 5
RL   Nokbun-Dong, Eunpyung-Ku, Seoul 122-701, Korea
XX
RN   [3]
RC   Sequence update by submitter
RP   1-868
RA   Moon S.-M., Gu H., Lee J.-K., Oh B.;
RT   ;
RL   Submitted (11-APR-2005) to the INSDC.
RL   Functional and Structural Genomics, National Genome Research Institute, 5
RL   Nokbun-Dong, Eunpyung-Ku, Seoul 122-701, Korea
XX
DR   MD5; 71cee46c675285944adb3cd3100fb881.
DR   H-InvDB; HIT000333211_04.4.
DR   H-InvDB; HIT000333211_05.4.
XX
CC   On Apr 11, 2005 this sequence version replaced gi:61658253.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..868
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /cell_line="GRB2010154"
FT                   /db_xref="taxon:9606"
FT   gene            1..868
FT                   /gene="HLA-DOA"
FT   CDS             25..210
FT                   /codon_start=1
FT                   /gene="HLA-DOA"
FT                   /product="truncated MHC class II antigen"
FT                   /db_xref="H-InvDB:HIT000333211_03.4"
FT                   /db_xref="IMGT/HLA:DOA*01:04N"
FT                   /protein_id="AAX49512.2"
FT                   /translation="MALRAGLVLGFHTLMTLLSPQEAGATKADHMGSYGPPSTSLTAPR
FT                   ASSPMNLMRNSCSLWT"
FT   variation       131^132
FT                   /gene="HLA-DOA"
FT                   /replace="c"
FT                   /note="results in full length product; compared to
FT                   HLA-DOA*01010202"
XX
SQ   Sequence 868 BP; 163 A; 278 C; 242 G; 185 T; 0 other;
     atttgattaa agcaccagag tgtaatggcc ctcagagcag ggctggtcct ggggttccac        60
     accctgatga ccctcctgag cccgcaggag gcaggggcca ccaaggctga ccacatgggc       120
     tcctacggac cgccttctac cagtcttacg gcgcctcggg ccagttcacc catgaatttg       180
     atgaggaaca gctgttctct gtggacctga agaaaagcga ggccgtgtgg cgtctgcctg       240
     agtttggtga ctttgcccgc tttgacccgc agggcgggct ggccggcatc gccgcaatca       300
     aagcccatct ggacatcctg gtggagcgct ccaaccgcag cagagccatc aacgtgcctc       360
     cacgggtgac cgtgctcccc aagtctcggg tggagctggg ccagcccaac atcctcatct       420
     gcatcgtgga caacatcttc ccccctgtga tcaatatcac ctggctgcgc aacggccaaa       480
     ctgtcactga gggagtggcc cagaccagct tctattccca gcctgaccat ttgttccgca       540
     agttccacta cctgcccttc gtgccctcag ccgaggacgt ctatgactgc caggtggagc       600
     actggggcct ggatgcgcca ctcctcaggc attgggagct ccaggtgcct attccaccac       660
     cagatgccat ggagaccctg gtctgtgccc tgggcctggc catcggcctg gtgggcttcc       720
     tcgtgggcac cgtcctcatc atcatgggca catatgtgtc cagtgtcccc aggtaatgat       780
     ccttctgaga gaaatgactt gtgggagaca ccctgcagat cctcatgggt ttgtgacagc       840
     ccctgcgtgc tcagtgccct ttaagtgc                                          868
//


spacer
spacer