spacer

EBI Dbfetch

ID   AY947479; SV 1; linear; mRNA; STD; HUM; 869 BP.
XX
AC   AY947479;
XX
DT   26-MAR-2005 (Rel. 83, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Homo sapiens GRB2012722 MHC class II antigen (HLA-DOA) mRNA, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-869
RX   DOI; 10.1111/j.1399-0039.2005.00446.x.
RX   PUBMED; 16101837.
RA   Moon S.M., Gu H., Ryu H.J., Kim J.J., Kim H.T., Han B.G., Kimm K.,
RA   Lee J.K., Oh B.;
RT   "Identification of four novel HLA-DOA alleles, DOA*010106, DOA*0102,
RT   DOA*0103, and DOA*0104N, by sequence-based typing*";
RL   Tissue Antigens 66(3):242-245(2005).
XX
RN   [2]
RP   1-869
RA   Moon S.-M., Gu H., Lee J.-K., Oh B.;
RT   ;
RL   Submitted (27-FEB-2005) to the INSDC.
RL   Functional and Structural Genomics, National Genome Research Institute, 5
RL   Nokbun-Dong, Eunpyung-Ku, Seoul 122-701, Korea
XX
DR   MD5; 3dded40caf8102f6dd2ef659d9de3e70.
DR   Ensembl-Gn; ENSG00000204252; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206292; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230141; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231558; homo_sapiens.
DR   Ensembl-Gn; ENSG00000232957; homo_sapiens.
DR   Ensembl-Gn; ENSG00000232962; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235744; homo_sapiens.
DR   Ensembl-Tr; ENST00000229829; homo_sapiens.
DR   Ensembl-Tr; ENST00000383226; homo_sapiens.
DR   Ensembl-Tr; ENST00000426070; homo_sapiens.
DR   Ensembl-Tr; ENST00000426685; homo_sapiens.
DR   Ensembl-Tr; ENST00000434335; homo_sapiens.
DR   Ensembl-Tr; ENST00000438987; homo_sapiens.
DR   Ensembl-Tr; ENST00000452598; homo_sapiens.
DR   H-InvDB; HIT000333208_04.4.
DR   H-InvDB; HIT000333208_05.4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..869
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /cell_line="GRB2012722"
FT                   /db_xref="taxon:9606"
FT   gene            1..869
FT                   /gene="HLA-DOA"
FT   CDS             25..777
FT                   /codon_start=1
FT                   /gene="HLA-DOA"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:P06340"
FT                   /db_xref="H-InvDB:HIT000333208_03.4"
FT                   /db_xref="HGNC:HGNC:4936"
FT                   /db_xref="IMGT/HLA:DOA*01:01:06"
FT                   /db_xref="InterPro:IPR001003"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:4I0P"
FT                   /db_xref="UniProtKB/Swiss-Prot:P06340"
FT                   /protein_id="AAX49509.1"
FT                   /translation="MALRAGLVLGFHTLMTLLSPQEAGATKADHMGSYGPAFYQSYGAS
FT                   GQFTHEFDEEQLFSVDLKKSEAVWRLPEFGDFARFDPQGGLAGIAAIKAHLDILVERSN
FT                   RSRAINVPPRVTVLPKSRVELGQPNILICIVDNIFPPVINITWLRNGQTVTEGVAQTSF
FT                   YSQPDHLFRKFHYLPFVPSAEDVYDCQVEHWGLDAPLLRHWELQVPIPPPDAMETLVCA
FT                   LGLAIGLVGFLVGTVLIIMGTYVSSVPR"
FT   variation       159
FT                   /gene="HLA-DOA"
FT                   /replace="g"
FT                   /note="compared to HLA-DOA*01010202"
FT   variation       276
FT                   /gene="HLA-DOA"
FT                   /replace="c"
FT                   /note="compared to HLA-DOA*01010202"
FT   variation       468
FT                   /gene="HLA-DOA"
FT                   /replace="a"
FT                   /note="compared to HLA-DOA*01010202"
XX
SQ   Sequence 869 BP; 165 A; 278 C; 240 G; 186 T; 0 other;
     atttgattaa agcaccagag tgtaatggcc ctcagagcag ggctggtcct ggggttccac        60
     accctgatga ccctcctgag cccgcaggag gcaggggcca ccaaggctga ccacatgggc       120
     tcctacggac ccgccttcta ccagtcttac ggcgcctcag gccagttcac ccatgaattt       180
     gatgaggaac agctgttctc tgtggacctg aagaaaagcg aggccgtgtg gcgtctgcct       240
     gagtttggtg actttgcccg ctttgacccg cagggtgggc tggccggcat cgccgcaatc       300
     aaagcccatc tggacatcct ggtggagcgc tccaaccgca gcagagccat caacgtgcct       360
     ccacgggtga ccgtgctccc caagtctcgg gtggagctgg gccagcccaa catcctcatc       420
     tgcatcgtgg acaacatctt cccccctgtg atcaatatca cctggctacg caacggccaa       480
     actgtcactg agggagtggc ccagaccagc ttctattccc agcctgacca tttgttccgc       540
     aagttccact acctgccctt cgtgccctca gccgaggacg tctatgactg ccaggtggag       600
     cactggggcc tggatgcgcc actcctcagg cattgggagc tccaggtgcc tattccacca       660
     ccagatgcca tggagaccct ggtctgtgcc ctgggcctgg ccatcggcct ggtgggcttc       720
     ctcgtgggca ccgtcctcat catcatgggc acatatgtgt ccagtgtccc caggtaatga       780
     tccttctgag agaaatgact tgtgggagac accctgcaga tcctcatggg tttgtgacag       840
     cccctgcgtg ctcagtgccc tttaagtgc                                         869
//


spacer
spacer