spacer

EBI Dbfetch

ID   AY935719; SV 1; linear; mRNA; STD; HUM; 796 BP.
XX
AC   AY935719;
XX
DT   19-MAR-2005 (Rel. 83, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) mRNA, HLA-DRB1-DRB1*1446
DE   allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-796
RX   DOI; 10.1016/j.humimm.2006.09.002.
RX   PUBMED; 17174751.
RA   Balas A., Vilches C., Rodriguez M.A., Fernandez B., Martinez M.P.,
RA   de Pablo R., Garcia-Sanchez F., Vicario J.L.;
RT   "Group-specific amplification of cDNA from DRB1 genes. Complete coding
RT   sequences of partially defined alleles and identification of the new
RT   alleles DRB1*040602, DRB1*111102, DRB1*080103, and DRB1*0113";
RL   Hum. Immunol. 67(12):1008-1016(2006).
XX
RN   [2]
RP   1-796
RA   Balas A., Garcia-Sanchez F., Vicario J.L.;
RT   ;
RL   Submitted (16-FEB-2005) to the INSDC.
RL   Histocompatibility, CTM, Avenida de La Democracia, Madrid 28032, Spain
XX
DR   MD5; 50a11e3a9a4eb39f7b658346ce464384.
DR   Ensembl-Gn; ENSG00000196126; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206240; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206306; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228080; homo_sapiens.
DR   Ensembl-Tr; ENST00000328980; homo_sapiens.
DR   Ensembl-Tr; ENST00000360004; homo_sapiens.
DR   Ensembl-Tr; ENST00000399450; homo_sapiens.
DR   Ensembl-Tr; ENST00000412634; homo_sapiens.
DR   Ensembl-Tr; ENST00000415796; homo_sapiens.
DR   Ensembl-Tr; ENST00000419393; homo_sapiens.
DR   Ensembl-Tr; ENST00000428566; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..796
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   gene            1..>796
FT                   /gene="HLA-DRB1"
FT                   /allele="DRB1*1446"
FT   CDS             1..>796
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /allele="DRB1*1446"
FT                   /product="MHC class II antigen"
FT                   /note="contains exons 1-6"
FT                   /db_xref="GOA:Q9GIY3"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*14:46"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9GIY3"
FT                   /protein_id="AAX33315.1"
FT                   /translation="MVCLRLPGGSCMAVLTVTLMVLSSPLALAGDTRPRFLELRKSECH
FT                   FFNGTERVRFLERYFHNQEENVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAV
FT                   DTYCRHNYGVGESFTVQRRVHPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRN
FT                   GQEEKTGVVSTGLIHNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSE
FT                   SAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPRGFL"
XX
SQ   Sequence 796 BP; 170 A; 200 C; 260 G; 166 T; 0 other;
     atggtgtgtc tgaggctccc tggaggctcc tgcatggcag ttctgacagt gacactgatg        60
     gtgctgagct ccccactggc tttggctggg gacaccagac cacgtttctt ggagctgcgt       120
     aagtctgagt gtcatttctt caatgggacg gagcgggtgc ggttcctgga gagatacttc       180
     cataaccagg aggagaacgt gcgcttcgac agcgacgtgg gggagtaccg ggcggtgacg       240
     gagctggggc ggcctgatgc cgagtactgg aacagccaga aggacctcct ggagcagagg       300
     cgggccgcgg tggacaccta ctgcagacac aactacgggg ttggtgagag cttcacagtg       360
     cagcggcgag tccatcctaa ggtgactgtg tatccttcaa agacccagcc cctgcagcac       420
     cacaacctcc tggtctgttc tgtgagtggt ttctatccag gcagcattga agtcaggtgg       480
     ttccggaatg gccaggaaga gaagactggg gtggtgtcca caggcctgat ccacaatgga       540
     gactggacct tccagaccct ggtgatgctg gaaacagttc ctcggagtgg agaggtttac       600
     acctgccaag tggagcaccc aagcgtgaca agccctctca cagtggaatg gagagcacgg       660
     tctgaatctg cacagagcaa gatgctgagt ggagtcgggg gctttgtgct gggcctgctc       720
     ttccttgggg ccgggctgtt catctacttc aggaatcaga aaggacactc tggacttcag       780
     ccaagaggat tcctga                                                       796
//


spacer
spacer