spacer

EBI Dbfetch

ID   AH014690; SV 2; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   AH014690; AY935260-AY935261;
XX
DT   31-JUL-2011 (Rel. 109, Created)
DT   31-JUL-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*4101 variant allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RA   Lazaro A.M., Cao K., Hurley C.K.;
RT   "Novel HLA-class I allele";
RL   Unpublished.
XX
RN   [2]
RP   1-646
RA   Lazaro A.M., Cao K., Hurley C.K.;
RT   ;
RL   Submitted (14-FEB-2005) to the INSDC.
RL   Oncology, Georgetown University, 3970 Reservoir Rd., N.W., Washington, DC
RL   20057, USA
XX
CC   On or before Jul 29, 2011 this sequence version replaced
CC   gi:60684784, gi:60684785, gi:60684783.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>646
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4101 variant"
FT   mRNA            join(<1..270,371..>646)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4101 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4101 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q58P06"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q58P06"
FT                   /protein_id="AAX34393.1"
FT                   /translation="SHSMRYFHTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGSHTWQRMYGCDLGP
FT                   DGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQDRAYLEGTC
FT                   VEWLRRYLENGKDTLERA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4101 variant"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4101 variant"
FT                   /number=3
XX
SQ   Sequence 646 BP; 114 A; 171 C; 191 G; 70 T; 100 other;
     gctcccactc catgaggtat ttccacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcac cgtgggctac gtggacgaca cgctgttcgt gaggttcgac agcgacgcca       120
     cgagtccgag gaaggagccg cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac ttggcagagg atgtatggct gcgacctggg gccggacggg       420
     cgcctcctcc gcgggcataa ccagtacgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctgc gctcctggac cgcggcggac accgcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgtggcgga gcaggacaga gcctacctgg agggcacgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggac acgctggagc gcgcgg                      646
//


spacer
spacer