spacer

EBI Dbfetch

ID   AY918168; SV 1; linear; genomic DNA; STD; HUM; 2244 BP.
XX
AC   AY918168;
XX
DT   02-MAR-2005 (Rel. 83, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens isolate 40540S MHC class I antigen precursor (HLA-B) gene,
DE   HLA-B*5811 allele, exons 1 through 5 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2244
RA   Robbins F.-M., Adams S., Sumpter C., Wilson W., Stroncek D.;
RT   "Identification of novel class I alleles by direct sequencing of SSP-PCR
RT   products";
RL   Unpublished.
XX
RN   [2]
RP   1-2244
RA   Robbins F.-M., Adams S., Sumpter C., Wilson W., Stroncek D.;
RT   ;
RL   Submitted (03-FEB-2005) to the INSDC.
RL   Transfusion Medicine, NIH, CC, 10 Center Drive, Bethesda, MD 20892, USA
XX
DR   MD5; 2852dfaba2d7f539c955a05e97ac9501.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2244
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /isolate="40540S"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   gene            1..>2244
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5811"
FT   mRNA            join(1..160,290..559,805..1080,1656..1931,2036..>2152)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5811"
FT                   /product="MHC class I antigen precursor"
FT   exon            1..160
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5811"
FT                   /number=1
FT   5'UTR           1..87
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5811"
FT   CDS             join(88..160,290..559,805..1080,1656..1931,2036..>2152)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5811"
FT                   /product="MHC class I antigen precursor"
FT                   /note="antigen presenting molecule"
FT                   /db_xref="GOA:Q5D1X0"
FT                   /db_xref="IMGT/HLA:B*58:11"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q5D1X0"
FT                   /protein_id="AAX18629.1"
FT                   /translation="MRVTAPRTVLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDGETRNMKASAQTYRENLRI
FT                   ALRYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSS"
FT   sig_peptide     88..159
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5811"
FT   exon            290..559
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5811"
FT                   /number=2
FT   exon            805..1080
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5811"
FT                   /number=3
FT   exon            1656..1931
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5811"
FT                   /number=4
FT   exon            2036..2152
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5811"
FT                   /number=5
XX
SQ   Sequence 2244 BP; 416 A; 685 C; 734 G; 409 T; 0 other;
     tctagagaag ccaatcagtg tcgccggggt cccagttcta aagtccccac gcacccaccc        60
     ggactcagaa tctcctcaga cgccgagatg cgggtcacgg cgccccgaac cgtcctcctg       120
     ctgctctggg gggcagtggc cctgaccgag acctgggccg gtgagtgcgg ggtcgggagg       180
     gaaatggcct ctgtggggag gagcgagggg accgcaggcg ggggcgcagg acctgaggag       240
     ccgcgccggg aggagggtcg ggcgggtctc agcccctcct cgcccccagg ctcccactcc       300
     atgaggtatt tctacaccgc catgtcccgg cccggccgcg gggagccccg cttcatcgca       360
     gtgggctacg tggacgacac ccagttcgtg aggttcgaca gcgacgccgc gagtccgagg       420
     acggagcccc gggcgccatg gatagagcag gaggggccgg agtattggga cggggagaca       480
     cggaacatga aggcctccgc gcagacttac cgagagaacc tgcggatcgc gctccgctac       540
     tacaaccaga gcgaggccgg tgagtgaccc cggcccgggg cgcaggtcac gactccccat       600
     cccccacgta cggcccgggt cgccccgagt ctccgggtcc gagatccgcc tccctgaggc       660
     cgcgggaccc gcccagaccc tcgaccggcg agagccccag gcgcgtttac ccggtttcat       720
     tttcagttga ggccaaaatc cccgcgggtt ggtcggggcg gggcggggct cgggggacgg       780
     ggctgaccgc ggggccgggg ccagggtctc acatcatcca gaggatgtat ggctgcgacc       840
     tggggcccga cgggcgcctc ctccgcgggc atgaccagtc cgcctacgac ggcaaggatt       900
     acatcgccct gaacgaggac ctgagctcct ggaccgcggc ggacaccgcg gctcagatca       960
     cccagcgcaa gtgggaggcg gcccgtgtgg cggagcagct gagagcctac ctggagggcc      1020
     tgtgcgtgga gtggctccgc agatacctgg agaacgggaa ggagacgctg cagcgcgcgg      1080
     gtaccagggg cagtggggag ccttccccat ctcctatagg tcgccgggga tggcctccca      1140
     cgagaagagg aggaaaatgg gatcagcgct agaatgtcgc cctcccttga atggagaatg      1200
     gcatgagttt tcctgagttt cctctgaggg ccccctcttc tctctaggac aattaaggga      1260
     tgacgtctct gaggaaatgg aggggaagac agtccctaga atactgatca ggggtcccct      1320
     ttgacccctg cagcagcctt gggaaccgtg acttttcctc tcaggccttg ttctctgcct      1380
     cacactcagt gtgtttgggg ctctgattcc agcacttctg agtcacttta cctccactca      1440
     gatcaggagc agaagtccct gttccccgct cagagactcg aactttccaa tgaataggag      1500
     attatcccag gtgcctgcgt ccaggctggt gtctgggttc tgtgcccctt ccccacacca      1560
     ggtgtcctgt ccattctcag gctggtcaca tgggtggtcc tagggtgtcc catgagagat      1620
     gcaaagcgcc tgaattttct gactcttccc atcagacccc ccaaagacac acgtgaccca      1680
     ccaccccatc tctgaccatg aggccaccct gaggtgctgg gccctgggct tctaccctgc      1740
     ggagatcaca ctgacctggc agcgggatgg cgaggaccaa actcaggaca ctgagcttgt      1800
     ggagaccaga ccagcaggag atagaacctt ccagaagtgg gcagctgtgg tggtgccttc      1860
     tggagaagag cagagataca catgccatgt acagcatgag gggctgccga agcccctcac      1920
     cctgagatgg ggtaaggagg gggatgaggg gtcatatctc ttctcaggga aagcaggagc      1980
     ccttctggag cccttcagca gggtcagggc ccctcgtctt cccctccttt cccagagcca      2040
     tcttcccagt ccaccatccc catcgtgggc attgttgctg gcctggctgt cctagcagtt      2100
     gtggtcatcg gagctgtggt cgctactgtg atgtgtagga ggaagagctc aggtagggaa      2160
     ggggtgaggg gtggggtctg ggttttcttg tcccactggg ggtttcaagc cccaggtaga      2220
     agtgttccct gcctcattac tggg                                             2244
//


spacer
spacer