Dbfetch

ID   AY912075; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AY912075;
XX
DT   05-DEC-2005 (Rel. 86, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 7)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1-DRB1*14 variant
DE   allele, exon and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RX   DOI; 10.1111/j.1744-313X.2005.00557.x.
RX   PUBMED; 16426240.
RA   Miao K.R., Xue M., Zhou X.Y., Xu R., Fei X.M., Pan Q.Q., Zhang J.W.,
RA   Zhao X., Fan S., Kukuruga D., Xu A.L., Wang C.Y.;
RT   "Characterization of a novel DRB1*14 allele (DRB1*1449) in the Han-Chinese
RT   population";
RL   Int. J. Immunogenet. 33(1):33-35(2006).
XX
RN   [2]
RP   1-270
RA   Wang C., Miao K.;
RT   ;
RL   Submitted (28-JAN-2005) to the INSDC.
RL   HLA Lab, The First Affiliated Hospital of Naning Medical University,
RL   P.R.China, 300 Guangzhou Road, Nanjing, Jiangsu 210029, People Republic of
RL   China
XX
DR   MD5; ad610e3207d4957d03641bdbdccc8b6c.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="DRB1*14 variant"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="DRB1*14 variant"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="DRB1*14 variant"
FT                   /product="MHC class II antigen"
FT                   /note="HLA-DR antigen"
FT                   /db_xref="GOA:Q9GIY3"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*14:49"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9GIY3"
FT                   /protein_id="AAY17288.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLERYFHNQEEFVRFDSDVGEYRAV
FT                   TELGRPAAEHWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRR"
FT   exon            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="DRB1*14 variant"
FT                   /number=2
XX
SQ   Sequence 270 BP; 54 A; 66 C; 100 G; 50 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga gagatacttc cataaccagg aggagttcgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgctgc ggagcactgg aacagccaga       180
     aggacctcct ggagcagagg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//