Dbfetch

ID   AY904343; SV 1; linear; genomic DNA; STD; HUM; 1029 BP.
XX
AC   AY904343;
XX
DT   20-FEB-2005 (Rel. 82, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1029
RX   DOI; 10.1111/j.1399-0039.2005.00423.x.
RX   PUBMED; 15982259.
RA   Li J.P., Liu X.Z., Gao H.F., Liu X., Chen Y., Li X.F., Zhe Q., Gao J.B.,
RA   Zhang X., Lv Y.Z., Yang L.Y., Huang X.Y., Yu Y.Y., Yu F.Q., Chi L.P.;
RT   "Identification of a novel HLA-A allele HLA-A*2451 in a Chinese donor";
RL   Tissue Antigens 66(1):54-55(2005).
XX
RN   [2]
RP   1-1029
RA   Li J., Liu X., Zeng Z., Chen Y., Li X., Wu G., Gao H.;
RT   ;
RL   Submitted (25-JAN-2005) to the INSDC.
RL   HLA Dept., Liaoning Blood Center, 13 Beihai Street, Shenyang, Liaoning
RL   110044, China
XX
DR   MD5; e9588cdd92249692f058d0e7c43018ed.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1029
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p23"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <18..>1029
FT                   /gene="HLA-A"
FT   mRNA            join(<18..90,221..490,732..>1007)
FT                   /gene="HLA-A"
FT                   /product="MHC class I antigen"
FT   CDS             join(18..90,221..490,732..>1007)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:A*24:51"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q5EDD0"
FT                   /protein_id="AAX07135.1"
FT                   /translation="MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFSTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRI
FT                   ALRYYNQSEAGSHTLQIMYGCDVGPDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMA
FT                   AQITKRKWEAAHVAEQQRAYLEGTCVDGLRRYLENGKETLQRT"
XX
SQ   Sequence 1029 BP; 184 A; 339 C; 375 G; 131 T; 0 other;
     ctccccagac gccgaggatg gccgtcatgg cgccccgaac cctcgtcctg ctactctcgg        60
     gggccctggc cctgacccag acctgggcag gtgagtgcgg ggtcgggagg gaaacggcct       120
     ctgcggggag aagcaagggg cccgcctggc gggggcgcaa gacccgggaa gccgcgccgg       180
     gaggagggtc gggcgggtct cagccactcc tcgtccccag gctcccactc catgaggtat       240
     ttctccacat ccgtgtcccg gcccggccgc ggggagcccc gcttcatcgc cgtgggctac       300
     gtggacgaca cgcagttcgt gcggttcgac agcgacgccg cgagccagag gatggagccg       360
     cgggcgccgt ggatagagca ggaggggccg gagtattggg acgaggagac agggaaagtg       420
     aaggcccact cacagactga ccgagagaac ctgcggatcg cgctccgcta ctacaaccag       480
     agcgaggccg gtgagtgacc ccggcccggg gcacaggtca cgacccctca tcccccacgg       540
     acgggccggg tcgcccacag tctccgggtc cgagatccac cccgaagccg cgggaccccg       600
     agacccttgc cccgggagag gcccaggcgc cttaacccgg tttcattttc agtttaggcc       660
     aaaaatcccc ccgggttggt cggggccggg cggggctcgg gggactgggc cgaccgcggg       720
     gtcggggcca ggttctcaca ccctccagat aatgtatggc tgcgacgtgg ggccggacgg       780
     gcgcttcctc cgcgggtacc accagtacgc ctacgacggc aaggattaca tcgccctgaa       840
     agaggacctg cgctcttgga ccgcggcgga catggcggct cagatcacca agcgcaagtg       900
     ggaggcggcc catgtggcgg agcagcagag agcctacctg gagggcacgt gcgtggacgg       960
     gctccgcaga tacctggaga acgggaagga gacgctgcag cgcacgggta ccaggggcca      1020
     cgggacccg                                                              1029
//