spacer

EBI Dbfetch

ID   AY899825; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AY899825;
XX
DT   14-FEB-2005 (Rel. 82, Created)
DT   21-APR-2010 (Rel. 104, Last updated, Version 5)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*12 variant
DE   allele, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RX   PUBMED; 16456785.
RA   Zhu F.M., Zhang W., Lu Q.F., He J., Wang W., Han Z.D., Yan L.X.;
RT   "Sequence analysis of a novel HLA-DRB1 allele, DRB1 * 1212";
RL   Zhonghua Yi Xue Yi Chuan Xue Za Zhi 23(1):47-49(2006).
XX
RN   [2]
RP   1-270
RA   Zhu F., Lu Q., Zhang W.;
RT   "Identification a novel HLA-DRB1*12 in Chinese by sequence-based typed";
RL   Unpublished.
XX
RN   [3]
RP   1-270
RA   Zhu F., Lu Q., Zhang W., Yan L.;
RT   ;
RL   Submitted (20-JAN-2005) to the INSDC.
RL   HLA Laboratory, Transfusion Research Institution, Wulin Road 345, Hangzhou,
RL   Zhejiang 310006, China
XX
DR   MD5; db06b22eb295e73132d3d776cb8b10ca.
DR   Ensembl-Gn; ENSG00000206240; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206306; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228080; homo_sapiens.
DR   Ensembl-Tr; ENST00000328980; homo_sapiens.
DR   Ensembl-Tr; ENST00000399450; homo_sapiens.
DR   Ensembl-Tr; ENST00000412634; homo_sapiens.
DR   Ensembl-Tr; ENST00000415796; homo_sapiens.
DR   Ensembl-Tr; ENST00000419393; homo_sapiens.
DR   Ensembl-Tr; ENST00000428566; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*12 variant"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*12 variant"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*12 variant"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q95IE3"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*12:12"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q95IE3"
FT                   /protein_id="AAW82078.1"
FT                   /translation="RFLEYSTGECYFFNGTERVRLLERHFHNQEELLRFDSDVGEFRAV
FT                   TELGRPVAESWNSQKDLLEDRRAAVDTYCRHNYGAVESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*12 variant"
FT                   /number=2
XX
SQ   Sequence 270 BP; 54 A; 68 C; 98 G; 50 T; 0 other;
     cacgtttctt ggagtactct acgggtgagt gttatttctt caatgggacg gagcgggtgc        60
     ggttactgga gagacacttc cataaccagg aggagctcct gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgtcgc cgagtcctgg aacagccaga       180
     aggacctcct ggaagacagg cgcgccgcgg tggacaccta ttgcagacac aactacgggg       240
     ctgtggagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer