Dbfetch

ID   AY897620; SV 1; linear; genomic DNA; STD; HUM; 740 BP.
XX
AC   AY897620;
XX
DT   01-MAR-2005 (Rel. 83, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*02 allele, exons 1
DE   through 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-740
RA   Mele L., Balza G., Cagnati M., Verri M.G., Arata M.;
RT   "A new A*02 allele";
RL   Unpublished.
XX
RN   [2]
RP   1-740
RA   Mele L., Balza G., Cagnati M., Verri M.G., Arata M.;
RT   ;
RL   Submitted (21-JAN-2005) to the INSDC.
RL   Haematology and Transfusion Medicine, SS Antonio e Biagio Hospital, via
RL   Venezia 16, Alessandria, AL 15100, Italy
XX
DR   MD5; 3b275e50fcc595e9c723325baac1723b.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..740
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /isolation_source="hematological patient"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>740
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02"
FT   mRNA            join(<1..73,174..443,544..>740)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02"
FT                   /product="MHC class I antigen"
FT   CDS             join(1..73,174..443,544..>740)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:A*02:96"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q5D5C6"
FT                   /protein_id="AAX14022.1"
FT                   /translation="MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGT
FT                   LRGYYNQSEACSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMA
FT                   AQTTKHKWEAAHVAEQL"
FT   exon            <1..73
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02"
FT                   /number=1
FT   gap             74..173
FT                   /estimated_length=unknown
FT   exon            174..443
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02"
FT                   /number=2
FT   variation       443
FT                   /gene="HLA-A"
FT                   /replace="g"
FT                   /note="compared to HLA*0201 allele in GenBank Accession
FT                   Number AJ575565"
FT   gap             444..543
FT                   /estimated_length=unknown
FT   exon            544..>740
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02"
FT                   /number=3
XX
SQ   Sequence 740 BP; 101 A; 170 C; 184 G; 85 T; 200 other;
     atggccgtca tggcgccccg aaccctcgtc ctgctactct cgggggctct ggccctgacc        60
     cagacctggg cggnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnngctctca       180
     ctccatgagg tatttcttca catccgtgtc ccggcccggc cgcggggagc cccgcttcat       240
     cgcagtgggc tacgtggacg acacgcagtt cgtgcggttc gacagcgacg ccgcgagcca       300
     gaggatggag ccgcgggcgc cgtggataga gcaggagggt ccggagtatt gggacgggga       360
     gacacggaaa gtgaaggccc actcacagac tcaccgagtg gacctgggga ccctgcgcgg       420
     ctactacaac cagagcgagg cctnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       540
     nnngttctca caccgtccag aggatgtatg gctgcgacgt ggggtcggac tggcgcttcc       600
     tccgcgggta ccaccagtac gcctacgacg gcaaggatta catcgccctg aaagaggacc       660
     tgcgctcttg gaccgcggcg gacatggcag ctcagaccac caagcacaag tgggaggcgg       720
     cccatgtggc ggagcagttg                                                   740
//