spacer

EBI Dbfetch

ID   AH014661; SV 2; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   AH014661; AY887663-AY887664;
XX
DT   31-JUL-2011 (Rel. 109, Created)
DT   31-JUL-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*5502 variant allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RX   DOI; 10.1111/j.1399-0039.2006.00628.x.
RX   PUBMED; 16866897.
RA   Jeong S.M., Lee M.N., Park S.Y., Kwon O.J., Nah S.Y.;
RT   "Identification of a new HLA-B*55 allele, HLA-B*5519, in the Korean
RT   population";
RL   Tissue Antigens 68(2):183-185(2006).
XX
RN   [2]
RP   1-646
RA   Yang Y.S., Hur S.S., Hong S.A., Lee M.N., Kwon O.J.;
RT   ;
RL   Submitted (14-JAN-2005) to the INSDC.
RL   Molecular Genetics, BioSewoom Institute of Bioscience & Biotechnology,
RL   Wooyoung Technocenter 1F, #273-15, Sungsu 2-ga 3-dong, Sungdong-gu, Seoul
RL   133-831, Republic of Korea
XX
CC   On or before Jul 29, 2011 this sequence version replaced
CC   gi:59665501, gi:59665502, gi:59665500.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>646
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5502 variant"
FT   mRNA            join(<1..270,371..>646)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5502 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5502 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q5EFR3"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q5EFR3"
FT                   /protein_id="AAW88384.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSNAASPREE
FT                   PRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHTWQTMYGCDLGP
FT                   DGRLLRGHNQLAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5502 variant"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5502 variant"
FT                   /number=3
XX
SQ   Sequence 646 BP; 113 A; 168 C; 194 G; 71 T; 100 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gaggttcgac agcaacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatctac aaggcccagg cacagactga ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac ttggcagacg atgtatggct gcgacctggg gccggacggg       420
     cgcctcctcc gcgggcataa ccagttagcc tacgacggca aggattacat cgccctgaac       480
     gaggacctga gctcctggac cgcggcggac accgcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgtggcgga gcagctgaga gcctacctgg agggcacgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcgcgg                      646
//


spacer
spacer