spacer

EBI Dbfetch

ID   AY877348; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AY877348;
XX
DT   31-JAN-2005 (Rel. 82, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*1114 variant
DE   allele, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Ball E.J., Thomas D.M., Kawczak P.R., Schatz H.R., Jurcago R.E., Carr M.F.,
RA   Cook D.J.;
RT   "Polymorphism of HLA-DRB1* alleles";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Ball E.J., Thomas D.M., Kawczak P.R., Schatz H.R., Jurcago R.E., Carr M.F.,
RA   Cook D.J.;
RT   ;
RL   Submitted (05-JAN-2005) to the INSDC.
RL   Allogen Laboratories, The Cleveland Clinic Foundation, 9500 Euclid Avenue,
RL   Cleveland, OH 44195, USA
XX
DR   MD5; 1dbf5da784a8e8bca98c3776258965f5.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1114 variant"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1114 variant"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1114 variant"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q5FY46"
FT                   /db_xref="IMGT/HLA:DRB1*11:14:02"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FY46"
FT                   /protein_id="AAW66688.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAV
FT                   TELGRPDEEYWNSQKDILEDERAAVDTYCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1114 variant"
FT                   /number=2
XX
SQ   Sequence 270 BP; 58 A; 62 C; 98 G; 52 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgatga ggagtactgg aacagccaga       180
     aggacatcct ggaagacgag cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacggtg cagcggcgag                                        270
//


spacer
spacer