Dbfetch

ID   AY867868; SV 1; linear; genomic DNA; STD; HUM; 1843 BP.
XX
AC   AY867868;
XX
DT   27-JAN-2005 (Rel. 82, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*3933 allele, exons 2
DE   through 5 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1843
RA   Scott J.K., Avergas C.U., Iglehart B.S., Leffell M.S.;
RT   "Identification of a Novel Allele: B*3933";
RL   Unpublished.
XX
RN   [2]
RP   1-1843
RA   Scott J.K., Avergas C.U., Iglehart B.S., Leffell M.S.;
RT   ;
RL   Submitted (28-DEC-2004) to the INSDC.
RL   Medicine, Johns Hopkins University, 2041 E. Monument St, Baltimore, MD
RL   21205, USA
XX
DR   MD5; 68c027f29f45d7099f4e104ac3132b81.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1843
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <54..>1843
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3933"
FT   mRNA            join(<54..323,569..844,1417..1692,1786..>1843)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3933"
FT                   /product="MHC class I antigen"
FT   CDS             join(<54..323,569..844,1417..1692,1786..>1843)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3933"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:B*39:33"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q5G0G2"
FT                   /protein_id="AAW62302.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQICKTNTQTDRESLRNLRGYYNQSEAGSHTWQTMYGCDVGP
FT                   DGRLLRGHNQFAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQRRAYLEGLC
FT                   VEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPSSQSTV
FT                   PIVGIVAGLAVL"
FT   exon            54..323
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3933"
FT                   /number=2
FT   exon            569..844
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3933"
FT                   /number=3
FT   exon            1417..1692
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3933"
FT                   /number=4
FT   exon            1786..>1843
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3933"
FT                   /number=5
XX
SQ   Sequence 1843 BP; 354 A; 576 C; 580 G; 333 T; 0 other;
     ggagccgcgc cgggaggagg gtcgggcggg tctcagcccc tcctcgcccc caggctccca        60
     ctccatgagg tatttctaca cctccgtgtc ccggcccggc cgcggggagc cccgcttcat       120
     ctcagtgggc tacgtggacg acacgcagtt cgtgaggttc gacagcgacg ccgcgagtcc       180
     gagagaggag ccgcgggcgc cgtggataga gcaggagggg ccggaatatt gggaccggaa       240
     cacacagatc tgcaagacca acacacagac tgaccgagag agcctgcgga acctgcgcgg       300
     ctactacaac cagagcgagg ccggtgagtg accccggccc ggggcgcagg tcacgactcc       360
     ccatccccca cgtacggccc gggtcgcccc gagtctccgg gtccgagatc cgcctccctg       420
     aggccgcggg acccgcccag accctcgacc ggcgagagcc ccaggcgcgt ttacccggtt       480
     tcattttcag ttgaggccaa aatccccgcg ggttggtcgg ggcggggcgg ggctcggggg       540
     acggggctga ccgcggggcc ggggccaggg tctcacactt ggcagacgat gtatggctgc       600
     gacgtggggc cggacgggcg cctcctccgc gggcataacc agttcgccta cgacggcaag       660
     gattacatcg ccctgaacga ggacctgagc tcctggaccg cggcggacac cgcggctcag       720
     atcacccagc gcaagtggga ggcggcccgt gtggcggagc agcggagagc ctacctggag       780
     ggcctgtgcg tggagtggct ccgcagatac ctggagaacg ggaaggagac gctgcagcgc       840
     gcgggtacca ggggcagtgg ggagccttcc ccatctccta taggtcgccg gggatggcct       900
     ccaacgagaa gaagaggaaa atgggatcag cgctagaatg tcgccctccc ttgaatggag       960
     aatggcatga gttttcctga gtttcctctg agggccccct cttctctcta ggacaattaa      1020
     gggatgacgt ctctgaggaa atggagggga agacagtccc tagaatactg atcaggggtc      1080
     ccctttgacc cctgcagcag ccttgggaac catgactttt cctctcaggc cttgttctct      1140
     gcctcacact cagtgtgttt ggggctctga ttccagcact tctgagtcac tttacctcca      1200
     ctcagatcag gagcagaagt ctctgttccc cgctcagaga ctcgaacttt ccaatgaata      1260
     gattatccca ggtgcctgcg tccaggctgg tgtctgggtt ctgtgcccct tccccacccc      1320
     aggtgtcctg tccattctca ggctggtcac atgggtggtc ctagggtgtc ccatgagaga      1380
     tgcaaagcgc ctgaattttc tgactcttcc catcagaccc cccaaagaca catgtgaccc      1440
     accaccccat ctctgaccat gaggccaccc tgaggtgctg ggccctgggc ttctaccctg      1500
     cggagatcac actgacctgg cagcgggatg gcgaggacca aactcaggac accgagcttg      1560
     tggagaccag accagcagga gacagaacct tccagaagtg ggcagctgtg gtggtgcctt      1620
     ctggagaaga gcagagatac acatgccatg tacagcatga ggggctgccg aagcccctca      1680
     ccctgagatg gggtaaggag ggggatgagg ggtcatatct cttctcaggg aaagcaggag      1740
     cccttcagca gggtcagggc ccctcatctt cccctccttt cccagagcca tcttcccagt      1800
     ccaccgtccc catcgtgggc attgttgctg gcctggctgt cct                        1843
//