spacer

EBI Dbfetch

ID   AH014606; SV 2; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   AH014606; AY867798-AY867799;
XX
DT   31-JUL-2011 (Rel. 109, Created)
DT   31-JUL-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*6802 variant allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RA   Lazaro A.M., Cao K., Hurley C.K.;
RT   "Novel HLA-class I allele";
RL   Unpublished.
XX
RN   [2]
RP   1-646
RA   Lazaro A.M., Cao K., Hurley C.K.;
RT   ;
RL   Submitted (29-DEC-2004) to the INSDC.
RL   Oncology, Georgetown University, 3970 Reservoir Road, NW, Washington, DC
RL   20057, USA
XX
CC   On or before Jul 29, 2011 this sequence version replaced
CC   gi:57903182, gi:57903183, gi:57903181.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>646
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*6802 variant"
FT   mRNA            join(<1..270,371..>646)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*6802 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*6802 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q5G0H0"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q5G0H0"
FT                   /protein_id="AAW58070.1"
FT                   /translation="SHSMRYFYTSMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDRNTRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQRMYGCDVGP
FT                   DGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQRRAYLEGTC
FT                   VEWLRRYLENGKETLQRT"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*6802 variant"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*6802 variant"
FT                   /number=3
XX
SQ   Sequence 646 BP; 112 A; 166 C; 194 G; 74 T; 100 other;
     gctcccactc catgaggtat ttctacacct ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acggaatgtg aaggcccagt cacagactga ccgagtggac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn gttctcacac catccagagg atgtatggct gcgacgtggg gccggacggg       420
     cgcttcctcc gcgggtacca ccagtacgcc tacgacggca aggattacat cgccctgaaa       480
     gaggacctgc gctcttggac cgcggcggac atggcagctc agaccaccaa gcacaagtgg       540
     gaggcggccc atgtggcgga gcagcggaga gcctacctgg agggcacgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcacgg                      646
//


spacer
spacer