spacer

EBI Dbfetch

ID   AY855161; SV 1; linear; genomic DNA; STD; HUM; 264 BP.
XX
AC   AY855161;
XX
DT   10-JAN-2005 (Rel. 82, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens isolate 2004_1097 MHC class II antigen (HLA-DPB1) gene, exon 2
DE   and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-264
RA   Garbarino L., Chiesa A., Sacchi N., Pastori F., Cusano R., Bottero F.,
RA   Bossi R.;
RT   ;
RL   Submitted (10-DEC-2004) to the INSDC.
RL   Lab. Istocompatibilita, E.O. Ospedali Galliera, Via Volta 19/2, Genova, GE
RL   16128, Italy
XX
DR   MD5; 9a727cbbc1d458f01cc137e27e70746e.
DR   Ensembl-Gn; ENSG00000215048; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223865; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226826; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230763; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236693; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237710; homo_sapiens.
DR   Ensembl-Tr; ENST00000399500; homo_sapiens.
DR   Ensembl-Tr; ENST00000411749; homo_sapiens.
DR   Ensembl-Tr; ENST00000418931; homo_sapiens.
DR   Ensembl-Tr; ENST00000425130; homo_sapiens.
DR   Ensembl-Tr; ENST00000433800; homo_sapiens.
DR   Ensembl-Tr; ENST00000454006; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..264
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /isolate="2004_1097"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>264
FT                   /gene="HLA-DPB1"
FT   mRNA            <1..>264
FT                   /gene="HLA-DPB1"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>264
FT                   /codon_start=3
FT                   /gene="HLA-DPB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:P04440"
FT                   /db_xref="HGNC:HGNC:4940"
FT                   /db_xref="IMGT/HLA:DPB1*109:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:3LQZ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04440"
FT                   /protein_id="AAW33683.1"
FT                   /translation="NYVYQLRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTE
FT                   LGRPDEEYWNSQKDILEEERAVPDRMCRHNYELGGPMTLQRR"
FT   exon            1..264
FT                   /gene="HLA-DPB1"
FT                   /number=2
XX
SQ   Sequence 264 BP; 62 A; 63 C; 98 G; 41 T; 0 other;
     agaattacgt gtaccagtta cggcaggaat gctacgcgtt taatgggaca cagcgcttcc        60
     tggagagata catctacaac cgggaggagt tcgtgcgctt cgacagcgac gtgggggagt       120
     tccgggcggt gacggagctg gggcggcctg atgaggagta ctggaacagc cagaaggaca       180
     tcctggagga ggagcgggca gtgccggaca ggatgtgcag acacaactac gagctgggcg       240
     ggcccatgac cctgcagcgc cgag                                              264
//


spacer
spacer