Dbfetch

ID   AY834199; SV 1; linear; genomic DNA; STD; HUM; 1060 BP.
XX
AC   AY834199;
XX
DT   23-DEC-2004 (Rel. 82, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*0278 allele, exons 1
DE   through 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1060
RX   DOI; 10.1111/j.1399-0039.2005.00405.x.
RX   PUBMED; 15896205.
RA   Ji Y., Sun J.L., Du K.M., Xie J.H., Ji Y.H., Yang J.H., Fu M., Sun Y.,
RA   Jin Y., Liu D.Z., Zhao T.M.;
RT   "Identification of a novel HLA-A*0278 allele in a Chinese family";
RL   Tissue Antigens 65(6):564-566(2005).
XX
RN   [2]
RP   1-1060
RA   Ji Y., Sun J.-L., Du K.-M., Xie J.-H., Ji Y.-H., Yang J.-H., Fu M., Sun Y.,
RA   Jin Y., Liu D.-Z., Zhao T.-M.;
RT   ;
RL   Submitted (19-NOV-2004) to the INSDC.
RL   MCIGS/NIAID, National Institutes of Health, 50 South Drive, Bldg 50, Room
RL   5516, Bethesda, MD 10892, USA
XX
DR   MD5; bbf5da536007990b831995e87256f647.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1060
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <49..>1038
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0278"
FT   mRNA            join(<49..121,252..521,763..>1038)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0278"
FT                   /product="MHC class I antigen"
FT   CDS             join(49..121,252..521,763..>1038)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0278"
FT                   /product="MHC class I antigen"
FT                   /note="histocompatibility antigen; HLA-A antigen"
FT                   /db_xref="IMGT/HLA:A*02:78"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q5MD70"
FT                   /protein_id="AAW22618.1"
FT                   /translation="MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFYTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGT
FT                   LRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMA
FT                   AQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRT"
FT   exon            <49..121
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0278"
FT                   /number=1
FT   exon            252..521
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0278"
FT                   /number=2
FT   exon            763..1038
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0278"
FT                   /number=3
XX
SQ   Sequence 1060 BP; 185 A; 344 C; 385 G; 146 T; 0 other;
     tagtccgcac gcacccaccg ggactcagat tctccccaga cgccgaggat ggccgtcatg        60
     gcgccccgaa ccctcgtcct gctactctcg ggggctctgg ccctgaccca gacctgggcg       120
     ggtgagtgcg gggtcgggag ggaaacggcc tctgtgggga gaagcaacgg gcccgcctgg       180
     cgggggcgca ggacccggga agccgcgccg ggaggagggt cgggcgggtc tcagccactc       240
     ctcgtcccca ggctctcact ccatgaggta tttctacacc tccgtgtccc ggcccggccg       300
     cggggagccc cgcttcatcg cagtgggcta cgtggacgac acgcagttcg tgcggttcga       360
     cagcgacgcc gcgagccaga ggatggagcc gcgggcgccg tggatagagc aggagggtcc       420
     ggagtattgg gaccaggaga cacggaatgt gaaggcccag tcacagactg accgagtgga       480
     cctggggacc ctgcgcggct actacaacca gagcgaggcc ggtgagtgac cccggcccgg       540
     ggcgcaggtc acgacctctc atcccccacg gacgggccag gtcgcccaca gtctccgggt       600
     ccgagatccg ccccgaagcc gcgggacccc gagacccttg ccccgggaga ggcccaggcg       660
     cctttacccg gtttcatttt cagtttaggc caaaaatccc cccaggttgg tcggggcggg       720
     gcggggctcg ggggaccggg ctgaccgcgg ggtccgggcc aggttctcac accgtccaga       780
     ggatgtatgg ctgcgacgtg gggtcggact ggcgcttcct ccgcgggtac caccagtacg       840
     cctacgacgg caaggattac atcgccctga aagaggacct gcgctcttgg accgcggcgg       900
     acatggcagc tcagaccacc aagcacaagt gggaggcggc ccatgtggcg gagcagttga       960
     gagcctacct ggagggcacg tgcgtggagt ggctccgcag atacctggag aacgggaagg      1020
     agacgctgca gcgcacgggt accaggggcc acggggcgcc                            1060
//