Dbfetch

ID   AY833432; SV 1; linear; genomic DNA; STD; HUM; 1725 BP.
XX
AC   AY833432;
XX
DT   14-DEC-2004 (Rel. 82, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*1595 allele, exons 2
DE   through 4 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1725
RA   Avergas C.U., Eller S.R., Iglehart B.S., Leffell M.S.;
RT   "Identification of a novel allele: HLA B*1595";
RL   Unpublished.
XX
RN   [2]
RP   1-1725
RA   Avergas C.U., Eller S.R., Iglehart B.S., Leffell M.S.;
RT   ;
RL   Submitted (19-NOV-2004) to the INSDC.
RL   Medicine, Johns Hopkins University, 2041 E. Monument St, Baltimore, MD
RL   21205, USA
XX
DR   MD5; 6c7995d19e0d1e751d5a0e2104c08943.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1725
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1725
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1595"
FT   mRNA            join(<54..323,574..849,1425..>1700)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1595"
FT                   /product="MHC class I antigen"
FT   CDS             join(<54..323,574..849,1425..>1700)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1595"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:B*15:95"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q5MD87"
FT                   /protein_id="AAV91504.1"
FT                   /translation="SHFMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMA
FT                   PRAPWIEQEGPEYWDQETRNMKASAQTYRENLRIALRYYNQSEAGSHTWQRMYGCDLGP
FT                   DGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQLRAYLEGLC
FT                   VEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW"
FT   exon            54..323
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1595"
FT                   /number=2
FT   exon            574..849
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1595"
FT                   /number=3
FT   exon            1425..1700
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1595"
FT                   /number=4
XX
SQ   Sequence 1725 BP; 330 A; 531 C; 562 G; 302 T; 0 other;
     ggagccgcgc cgggaggagg gtcgggcggg tctcagcccc tcctcgcccc caggctccca        60
     cttcatgagg tatttctaca ccgccatgtc ccggcccggc cgcggggagc cccgcttcat       120
     cgcagtgggc tacgtggacg acacgcagtt cgtgaggttc gacagcgacg ccgcgagtcc       180
     gaggatggcg ccccgggcgc catggataga gcaggagggg ccggagtatt gggaccagga       240
     gacacggaac atgaaggcct ccgcgcagac ttaccgagag aacctgcgga tcgcgctccg       300
     ctactacaac cagagcgagg ccggtgagtg accccggccc ggggcgcagg tcacgactcc       360
     ccatccccca cgtacggccc gggtcgcccc gagtctccgg gtccgagatc cgcccccctg       420
     aggccgcggg acccgcccaa accctcgacc ggcgagagcc ccaggcgcgt ttacccggtt       480
     tcattttcag ttgaggccaa aatccccgcg ggttggtcgg ggcggggcgg ggcggggctc       540
     gggggacggg gctgaccgcg gggcctgggc cagggtctca cacttggcag aggatgtatg       600
     gctgcgacct ggggccggac gggcgcctcc tccgcgggca tgaccagtcc gcctacgacg       660
     gcaaggatta catcgccctg aacgaggacc tgagctcctg gaccgcggcg gacacggcgg       720
     ctcagatcac ccagcgcaag tgggaggcgg cccgtgaggc ggagcagctg agagcctacc       780
     tggagggcct gtgcgtggag tggctccgca gatacctgga gaacgggaag gagacgctgc       840
     agcgcgcggg taccaggggc agtggggagc cttccccatc tcctataggt cgccggggat       900
     ggcctcccac gagaagagga ggaaaatggg atcagcgcta gaatgtcgcc ctcccttgaa       960
     tggagaatgg catgagtttt cctgagtttc ctctgagggc cccctcttct ctctaggaca      1020
     attaagggat gacgtctctg aggaaatgga ggggaagaca gtccctagga tagtgatcag      1080
     gggtcccctt tgacccctgc agcagccttg ggaaccgtga cttttcctct caggccttgt      1140
     tctctgcctc acactcagtg tgtttggggc tctgattcca gcacttctga gtcactttac      1200
     ctccactcag atcaggagca gaagtccctg ttccccgctc agagactcga actttccaat      1260
     gaataggaga ttatcccagg tgcctgcgtc caggctggtg tctgggttct gtgccccttc      1320
     cccaccccag gtgtcctgtc cattctcagg ctggtcacat gggtggtcct agggtgtccc      1380
     atgagagatg caaagcgcct gaattttctg actcttccca tcagaccccc caaagacaca      1440
     tgtgacccac caccccatct ctgaccatga ggccaccctg aggtgctggg ccctgggctt      1500
     ctaccctgcg gagatcacac tgacctggca gcgggatggc gaggaccaaa ctcaggacac      1560
     cgagcttgtg gagaccagac cagcaggaga tagaaccttc cagaagtggg cagctgtggt      1620
     ggtgccttct ggagaagagc agagatacac atgccatgta cagcatgagg ggctgccgaa      1680
     gcccctcacc ctgagatggg gtaaggaggg ggatgagggg tcata                      1725
//