Dbfetch

ID   AY831404; SV 1; linear; mRNA; STD; HUM; 880 BP.
XX
AC   AY831404;
XX
DT   14-FEB-2005 (Rel. 82, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Homo sapiens MHC class II antigen (HLA-DPB1) mRNA, HLA-DPB1*0202 allele,
DE   complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-880
RX   DOI; 10.1007/s00251-005-0043-8.
RX   PUBMED; 16189666.
RA   Reinders J., Rozemuller E.H., van Gent R., Arts-Hilkes Y.H.,
RA   van den Tweel J.G., Tilanus M.G.;
RT   "Extended HLA-DPB1 polymorphism: an RNA approach for HLA-DPB1 typing";
RL   Immunogenetics 57(10):790-794(2005).
XX
RN   [2]
RP   1-880
RA   Reinders J., van Gent R., Rozemuller E.H., Tilanus M.G.J.;
RT   ;
RL   Submitted (19-NOV-2004) to the INSDC.
RL   Department of Pathology, H04.312, UMC Utrecht, Heidelberglaan 100, P.O. Box
RL   85500, Utrecht 3508 GA, The Netherlands
XX
DR   MD5; 2c64326a381d3fe861bfb7de853b9936.
DR   Ensembl-Gn; ENSG00000215048; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223865; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226826; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230763; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236693; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237710; homo_sapiens.
DR   Ensembl-Tr; ENST00000399500; homo_sapiens.
DR   Ensembl-Tr; ENST00000411749; homo_sapiens.
DR   Ensembl-Tr; ENST00000418931; homo_sapiens.
DR   Ensembl-Tr; ENST00000425130; homo_sapiens.
DR   Ensembl-Tr; ENST00000433800; homo_sapiens.
DR   Ensembl-Tr; ENST00000454006; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..880
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /cell_line="IHW09020; QBL"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>880
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*0202"
FT   CDS             1..777
FT                   /codon_start=1
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*0202"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:P04440"
FT                   /db_xref="H-InvDB:HIT000257876.14"
FT                   /db_xref="HGNC:HGNC:4940"
FT                   /db_xref="IMGT/HLA:DPB1*02:02"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:3LQZ"
FT                   /db_xref="PDB:4P4K"
FT                   /db_xref="PDB:4P4R"
FT                   /db_xref="PDB:4P57"
FT                   /db_xref="PDB:4P5K"
FT                   /db_xref="PDB:4P5M"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04440"
FT                   /protein_id="AAW80922.1"
FT                   /translation="MMVLQVSAAPRTVALTALLMVLLTSVVQGRATPENYLFQGRQECY
FT                   AFNGTQRFLERYIYNREELVRFDSDVGEFRAVTELGRPEAEYWNSQKDILEEERAVPDR
FT                   MCRHNYELGGPMTLQRRVQPRVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQ
FT                   EETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDVYTCQVEHTSLDSPVTVEWKAQSDSA
FT                   RSKTLTGAGGFVLGLIICGVGIFMHRRSKKVQRGSA"
FT   3'UTR           778..>880
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*0202"
XX
SQ   Sequence 880 BP; 198 A; 228 C; 276 G; 178 T; 0 other;
     atgatggttc tgcaggtttc tgcggccccc cggacagtgg ctctgacggc gttactgatg        60
     gtgctgctca catctgtggt ccagggcagg gccactccag agaattacct tttccaggga       120
     cggcaggaat gctacgcgtt taatgggaca cagcgcttcc tggagagata catctacaac       180
     cgggaggagc tcgtgcgctt cgacagcgac gtgggggagt tccgggcggt gacggagctg       240
     gggcggcctg aggcggagta ctggaacagc cagaaggaca tcctggagga ggagcgggca       300
     gtgccggaca ggatgtgcag acacaactac gagctgggcg ggcccatgac cctgcagcgc       360
     cgagtccagc ctagggtgaa tgtttccccc tccaagaagg ggcccttgca gcaccacaac       420
     ctgcttgtct gccacgtgac ggatttctac ccaggcagca ttcaagtccg atggttcctg       480
     aatggacagg aggaaacagc tggggtcgtg tccaccaacc tgatccgtaa tggagactgg       540
     accttccaga tcctggtgat gctggaaatg accccccagc agggagatgt ctacacctgc       600
     caagtggagc acaccagcct ggatagtcct gtcaccgtgg agtggaaggc acagtctgat       660
     tctgcccgga gtaagacatt gacgggagct gggggcttcg tgctggggct catcatctgt       720
     ggagtgggca tcttcatgca caggaggagc aagaaagttc aacgaggatc tgcataaaca       780
     gggttcctga gctcactgaa aagactattg tgccttagga aaagcatttg ctgtgtttcg       840
     ttagcatctg gctccaggac agaccttcaa cttccaaatt                             880
//