spacer

EBI Dbfetch

ID   AY831403; SV 1; linear; mRNA; STD; HUM; 832 BP.
XX
AC   AY831403;
XX
DT   14-FEB-2005 (Rel. 82, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Homo sapiens MHC class II antigen (HLA-DPB1) mRNA, HLA-DPB1*1301 allele,
DE   complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-832
RX   DOI; 10.1007/s00251-005-0043-8.
RX   PUBMED; 16189666.
RA   Reinders J., Rozemuller E.H., van Gent R., Arts-Hilkes Y.H.,
RA   van den Tweel J.G., Tilanus M.G.;
RT   "Extended HLA-DPB1 polymorphism: an RNA approach for HLA-DPB1 typing";
RL   Immunogenetics 57(10):790-794(2005).
XX
RN   [2]
RP   1-832
RA   Reinders J., van Gent R., Rozemuller E.H., Tilanus M.G.J.;
RT   ;
RL   Submitted (19-NOV-2004) to the INSDC.
RL   Department of Pathology, H04.312, UMC Utrecht, Heidelberglaan 100, P.O. Box
RL   85500, Utrecht 3508 GA, The Netherlands
XX
DR   MD5; 92d3ccfdb46f48b85bdbfaec5379dbe3.
DR   Ensembl-Gn; ENSG00000215048; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223865; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226826; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230763; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236693; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237710; homo_sapiens.
DR   Ensembl-Tr; ENST00000399500; homo_sapiens.
DR   Ensembl-Tr; ENST00000411749; homo_sapiens.
DR   Ensembl-Tr; ENST00000418931; homo_sapiens.
DR   Ensembl-Tr; ENST00000425130; homo_sapiens.
DR   Ensembl-Tr; ENST00000433800; homo_sapiens.
DR   Ensembl-Tr; ENST00000454006; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..832
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /cell_line="IHW09095; WIN"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>832
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*1301"
FT   5'UTR           <1..48
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*1301"
FT   CDS             49..825
FT                   /codon_start=1
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*1301"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:P04440"
FT                   /db_xref="H-InvDB:HIT000257875.13"
FT                   /db_xref="HGNC:HGNC:4940"
FT                   /db_xref="IMGT/HLA:DPB1*13:01:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:3LQZ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04440"
FT                   /protein_id="AAW80921.1"
FT                   /translation="MMVLQVSAAPRTVALTALLMVLLTSVVQGRATPENYVYQLRQECY
FT                   AFNGTQRFLERYIYNREEYARFDSDVGEFRAVTELGRPAAEYWNSQKDILEEERAVPDR
FT                   ICRHNYELDEAVTLQRRVQPKVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQ
FT                   EETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDVYICQVEHTSLDSPVTVEWKAQSDSA
FT                   RSKTLTGAGGFVLGLIICGVGIFMHRRSKKVQRGSA"
FT   3'UTR           826..>832
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*1301"
XX
SQ   Sequence 832 BP; 182 A; 224 C; 258 G; 168 T; 0 other;
     cttttcctga ctgcagctct tttcattttg ccatcctttt ccagctccat gatggttctg        60
     caggtttctg cggccccccg gacagtggct ctgacggcgt tactgatggt gctgctcaca       120
     tctgtggtcc agggcagggc cactccagag aattacgtgt accagttacg gcaggaatgc       180
     tacgcgttta atgggacaca gcgcttcctg gagagataca tctacaaccg ggaggagtac       240
     gcgcgcttcg acagcgacgt gggggagttc cgggcggtga cggagctggg gcggcctgct       300
     gcggagtact ggaacagcca gaaggacatc ctggaggagg agcgggcagt gccggacagg       360
     atatgcagac acaactacga gctggacgag gccgtgaccc tgcagcgccg agtccagcct       420
     aaggtgaacg tttccccctc caagaagggg cccctgcagc accacaacct gcttgtctgc       480
     cacgtgacag atttctaccc aggcagcatt caagtccgat ggttcctgaa tggacaggag       540
     gaaacagctg gggtcgtgtc caccaacctg atccgtaatg gagactggac cttccagatc       600
     ctggtgatgc tggaaatgac cccccagcag ggagacgtct acatctgcca agtggagcac       660
     accagcctgg acagtcctgt caccgtggag tggaaggcac agtctgattc tgcccggagt       720
     aagacattga cgggagctgg gggcttcgtg ctggggctca tcatctgtgg agtgggcatc       780
     ttcatgcaca ggaggagcaa gaaagttcaa cgaggatctg cataacaggg tt               832
//


spacer
spacer