spacer

EBI Dbfetch

ID   AY831402; SV 1; linear; mRNA; STD; HUM; 913 BP.
XX
AC   AY831402;
XX
DT   14-FEB-2005 (Rel. 82, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Homo sapiens MHC class II antigen (HLA-DPB1) mRNA, HLA-DPB1*0402 allele,
DE   complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-913
RX   DOI; 10.1007/s00251-005-0043-8.
RX   PUBMED; 16189666.
RA   Reinders J., Rozemuller E.H., van Gent R., Arts-Hilkes Y.H.,
RA   van den Tweel J.G., Tilanus M.G.;
RT   "Extended HLA-DPB1 polymorphism: an RNA approach for HLA-DPB1 typing";
RL   Immunogenetics 57(10):790-794(2005).
XX
RN   [2]
RP   1-913
RA   Reinders J., van Gent R., Rozemuller E.H., Tilanus M.G.J.;
RT   ;
RL   Submitted (19-NOV-2004) to the INSDC.
RL   Department of Pathology, H04.312, UMC Utrecht, Heidelberglaan 100, P.O. Box
RL   85500, Utrecht 3508 GA, The Netherlands
XX
DR   MD5; 3587308bfc9e5a5756653cdede7470c8.
DR   Ensembl-Gn; ENSG00000215048; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223865; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226826; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230763; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236693; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237710; homo_sapiens.
DR   Ensembl-Tr; ENST00000399500; homo_sapiens.
DR   Ensembl-Tr; ENST00000411749; homo_sapiens.
DR   Ensembl-Tr; ENST00000418931; homo_sapiens.
DR   Ensembl-Tr; ENST00000425130; homo_sapiens.
DR   Ensembl-Tr; ENST00000433800; homo_sapiens.
DR   Ensembl-Tr; ENST00000454006; homo_sapiens.
DR   H-InvDB; HIT000257874_03.4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..913
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /cell_line="IHW09291; APD; IHW09373; FH1"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>913
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*0402"
FT   5'UTR           <1..48
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*0402"
FT   CDS             49..825
FT                   /codon_start=1
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*0402"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:P04440"
FT                   /db_xref="H-InvDB:HIT000257874_02.4"
FT                   /db_xref="HGNC:HGNC:4940"
FT                   /db_xref="IMGT/HLA:DPB1*04:02:01:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:3LQZ"
FT                   /db_xref="PDB:4P4K"
FT                   /db_xref="PDB:4P4R"
FT                   /db_xref="PDB:4P57"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04440"
FT                   /protein_id="AAW80920.1"
FT                   /translation="MMVLQVSAAPRTVALTALLMVLLTSVVQGRATPENYLFQGRQECY
FT                   AFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTELGRPDEEYWNSQKDILEEKRAVPDR
FT                   MCRHNYELGGPMTLQRRVQPRVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQ
FT                   EETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDVYTCQVEHTSMDSPVTVEWKAQSDSA
FT                   RSKTLTGAGGFVLGLIICGVGIFMHRRSKKVQRGSA"
FT   3'UTR           826..>913
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*0402"
XX
SQ   Sequence 913 BP; 201 A; 238 C; 279 G; 195 T; 0 other;
     cttttcctga ctgcagctct tttcattttg ccatcctttt ccagctccat gatggttctg        60
     caggtttctg cggccccccg gacagtggct ctgacggcgt tactgatggt gctgctcaca       120
     tctgtggtcc agggcagggc cactccagag aattaccttt tccagggacg gcaggaatgc       180
     tacgcgttta atgggacaca gcgcttcctg gagagataca tctacaaccg ggaggagttc       240
     gtgcgcttcg acagcgacgt gggggagttc cgggcggtga cggagctggg gcggcctgat       300
     gaggagtact ggaacagcca gaaggacatc ctggaggaga agcgggcagt gccggacagg       360
     atgtgcagac acaactacga gctgggcggg cccatgaccc tgcagcgccg agtccagcct       420
     agggtgaatg tttccccctc caagaagggg cccttgcagc accacaacct gcttgtctgc       480
     cacgtgacgg atttctaccc aggcagcatt caagtccgat ggttcctgaa tggacaggag       540
     gaaacagctg gggtcgtgtc caccaacctg atccgtaatg gagactggac cttccagatc       600
     ctggtgatgc tggaaatgac cccccagcag ggagatgtct acacctgcca agtggagcac       660
     accagcatgg atagtcctgt caccgtggag tggaaggcac agtctgattc tgcccggagt       720
     aagacattga cgggagctgg gggcttcgtg ctggggctca tcatctgtgg agtgggcatc       780
     ttcatgcaca ggaggagcaa gaaagttcaa cgaggatctg cataaacagg gttcctgagc       840
     tcactgaaaa gactattgtg ccttaggaaa agcatttgct gtgtttcgtt agcatctggc       900
     tccaggacag acc                                                          913
//


spacer
spacer